(data stored in ACNUC7421 zone)

EMBL: CP001022.PE421

CP001022.PE421       Location/Qualifiers
FT   CDS_pept        complement(445717..446256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0427"
FT                   /product="Acireductone dioxygenase ARD"
FT                   /note="PFAM: Acireductone dioxygenase ARD; Cupin 2
FT                   conserved barrel domain protein; KEGG: bsu:BSU13620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59909"
FT                   /db_xref="GOA:B1YIX9"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR023956"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIX9"
FT                   /protein_id="ACB59909.1"
FT                   /translation="MATVLFQKTNERYTDQNEVSAFLASRGVLYEQWDVSKLPAELVDT
FT                   YTLTDADKQTILDTFQSEITDVSERRGYQTADIISLSDATPNLDELLVNFQKEHHHTDD
FT                   EVRFIVSGHGVFAIQDDEVGYYNIELNPGDLISVPVNTRHYFTLQEDRKVVAVRIFVTT
FT                   DGWVPIYEKDPIETAN"
     atggcaacag tacttttcca gaaaacaaac gaacggtata cggatcaaaa tgaggtatct        60
     gcttttctcg cttcacgtgg tgtcctgtat gaacaatggg atgtctcgaa gcttccggct       120
     gaactggtcg acacgtacac gttgacggat gcggacaaac aaacgattct tgatacattc       180
     caatcggaaa tcaccgatgt ttcggaacga cgcggttatc agacggctga tatcatctcc       240
     ctgtctgacg caacaccgaa cttggatgag ttgctcgtca acttccaaaa ggagcatcac       300
     catacggatg acgaagtccg gttcatcgtc agcgggcacg gtgtgtttgc gatccaggat       360
     gacgaagtcg gctattacaa cattgagttg aacccgggtg atttgatttc cgtaccagtc       420
     aacacacgcc attacttcac gctccaagag gatcgaaaag ttgtggcggt ccggattttc       480
     gtgacaacgg acggctgggt tccgatttat gagaaggatc cgattgaaac agcaaactaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page