(data stored in ACNUC7421 zone)

EMBL: CP001022.PE422

CP001022.PE422       Location/Qualifiers
FT   CDS_pept        complement(446272..446892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0428"
FT                   /product="methylthioribulose-1-phosphate dehydratase"
FT                   /note="TIGRFAM: methylthioribulose-1-phosphate dehydratase;
FT                   PFAM: class II aldolase/adducin family protein; KEGG:
FT                   bpu:BPUM_1254 possible aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59910"
FT                   /db_xref="GOA:B1YIY0"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY0"
FT                   /protein_id="ACB59910.1"
FT                   /translation="MTFLTRYEELRAIKQEFAARDWFPGTSGNLAIRTNSSPTEFLVTA
FT                   SGKDKRQDTPDDFVHVDATGQLIGEQNGRPSAETLLHVEVFNRTTAGCSLHVHTVDNNV
FT                   ISELYGDRGEIRFRSQEIIKALGRWEEDAEVIVPIITNHADIPTLAADFAKHIRTESGA
FT                   VLIRNHGITVWAPTAFEAKKQLEAFEFLFSYTLKLQACRQAIY"
     atgacatttt tgacacgata cgaagaactc cgcgccatca aacaagagtt cgcagcgcgg        60
     gactggtttc ccggtacaag cggtaacctc gctattcgga caaacagcag tccgacggaa       120
     ttccttgtga cggcaagcgg gaaagataaa cggcaggaca cgccggacga ttttgtccat       180
     gtcgacgcga ccggtcaatt gatcggcgag caaaatggac gtccttccgc cgagacgttg       240
     ctgcatgtcg aagtgtttaa ccggacgaca gccggctgct cgcttcatgt ccataccgtc       300
     gacaacaacg ttatttcgga actgtacgga gaccgcgggg aaatccggtt ccgcagtcag       360
     gaaatcatca aagcactcgg ccgttgggaa gaagatgcgg aagtcatcgt gccgatcatc       420
     acgaatcatg ccgacatccc gactcttgcc gctgactttg ccaaacacat ccggaccgaa       480
     agcggcgccg ttttgattcg caatcacggc atcacggttt gggcaccgac tgcttttgaa       540
     gccaaaaaac agttggaagc ttttgaattt ttgttcagct acaccttaaa actgcaagcg       600
     tgccgacagg cgatttatta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page