(data stored in ACNUC7421 zone)

EMBL: CP001022.PE423

CP001022.PE423       Location/Qualifiers
FT   CDS_pept        complement(446889..447548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0429"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; HAD-superfamily hydrolase subfamily IB
FT                   hypothetical 1; KEGG: gka:GK0954
FT                   2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59911"
FT                   /db_xref="GOA:B1YIY1"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR017718"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY1"
FT                   /protein_id="ACB59911.1"
FT                   /translation="MTIRILCDFDGTVTEHDNIIALMTEFAPPEAFEPLKKGVLDQSLS
FT                   IQSGVGQMFRLLPSDRKQDYIDFLEQRAVIRPGFKTLLAFAKSNGIDFAIVSGGIDFFV
FT                   QPILQELLTDEAIYCNGSDFSGETIRIEWPHTCDAACNNQCGCCKTSIARKLKQDGDII
FT                   VTIGDSVTDFELAKQADHVYARDYLITLCEQHGIAYTPFETFYDIVDHLQTTEVYA"
     atgacgatcc ggattttatg tgactttgac gggaccgtga ctgaacacga caatatcatt        60
     gcgttgatga cagaattcgc tcccccggaa gcgtttgaac cgttgaaaaa aggtgtcctc       120
     gatcaatcgc tgtccatcca gtccggtgtc ggacagatgt tccggttgct cccctcggat       180
     cgcaaacagg actatattga ttttttggaa cagcgggctg tcatccgtcc cggctttaag       240
     accttactcg cctttgccaa atcgaacggg attgactttg cgatcgtcag cggcggaatc       300
     gacttttttg tccaaccgat tcttcaagag ttactgacag atgaagcgat ttactgcaac       360
     ggcagtgact tcagcgggga gacgattcgt attgagtggc cgcacacttg cgatgcagca       420
     tgcaacaatc aatgcgggtg ttgtaaaacg tcgattgccc ggaagctcaa gcaggatggc       480
     gatattatcg tcacgatcgg tgactccgtg acggattttg aactggcgaa acaagcggat       540
     catgtctatg cccgcgatta tctgattacg ctgtgcgaac agcacgggat tgcatacaca       600
     ccatttgaaa cattttacga cattgttgat catctgcaga caacggaggt gtacgcatga       660
//

If you have problems or comments...

PBIL Back to PBIL home page