(data stored in ACNUC7421 zone)

EMBL: CP001022.PE424

CP001022.PE424       Location/Qualifiers
FT   CDS_pept        complement(447545..448735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0430"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /note="PFAM: ribulose bisphosphate carboxylase large chain;
FT                   KEGG: bpu:BPUM_1252 rmethionine salvage pathway
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59912"
FT                   /db_xref="GOA:B1YIY2"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR017717"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY2"
FT                   /protein_id="ACB59912.1"
FT                   /translation="MTYITATYQLGTTDQLPKRAEQIALGLTVGSWTDLNHLEQQQLES
FT                   FKGQVVHTEEHDGKGYITIRYPEHNVSRDFSAILTTVFGKLSLDGQIKLTDLQLPASFT
FT                   TDFPGAKFGIEGVRQLIQVHDRPLLMSIFKGVIGRDLTFLREQLEAQLAGGIDLVKDDE
FT                   ILYDNPLTPALDRARIGRDVLNAHYEKTGKRALYAITLSGSVFGLKDQTKRLIEAGATA
FT                   FLLNTFTYGLDVLRELAADPDISVPIFNHPALSGALIASPEYGIAAPVLLGTLPRLAGA
FT                   DLTLFPSPYGNVALAKDLARGIAVEATRIGETKTILPVPSAGIHPGLVAQLVHDFGTDS
FT                   VINAGGGVHGHPQGAAAGVLAFRQALDAALAGESLTSAATRQEELRVALDAWGITK"
     atgacgtata ttaccgcaac ctaccaactc ggaacgacgg atcagttacc aaaacgggca        60
     gaacaaatcg cgctcggttt gaccgtcggt tcctggaccg atttaaatca tttggaacaa       120
     cagcagcttg aatcgttcaa aggacaagtt gttcatacgg aagaacacga cggaaaaggc       180
     tacatcacga tccgttatcc ggaacacaac gtctcccgtg acttttcagc aatcttaacg       240
     accgtcttcg gcaagctgtc gctcgacgga caaatcaaat taacggattt acagcttccg       300
     gcttcgttca ccacggactt ccccggtgcc aaattcggca tcgagggcgt ccggcagttg       360
     attcaagtcc acgaccgtcc tctgttgatg agcatcttta aaggcgtcat cggtcgggac       420
     ctcacctttt tgcgggaaca actcgaagcg caacttgcgg gtggcatcga tctcgtcaaa       480
     gatgatgaga ttttgtacga taatccgttg acgccggcac tcgaccgggc gcggatcgga       540
     cgcgacgtcc taaatgccca ttatgaaaag accggcaaac gggcgcttta cgcgattacg       600
     ctgagcggtt ccgtcttcgg cttgaaggat cagacgaaac gtttgattga agccggtgcg       660
     accgcctttc tgctcaatac gtttacatac ggactcgacg tcttacgcga attagcggct       720
     gatccggaca tttccgttcc gatttttaat catccggcct taagcggtgc cttgatcgca       780
     agcccggaat acggcattgc agcccctgtt ttactaggga ctttaccgcg gctggccggt       840
     gccgatttga cgttgttccc gtcgccttac ggaaacgtcg ccctcgccaa agacttggcg       900
     cgcggaattg ccgtcgaagc cacacggatc ggagaaacga agacgattct tccggttccc       960
     tcggcaggca ttcatcccgg tctcgtcgct cagctcgttc atgatttcgg gaccgattcc      1020
     gtcatcaatg ccggtggcgg cgttcacggt catccgcagg gcgcggcggc cggtgtgctc      1080
     gctttccgtc aggccctcga cgcagcactt gccggtgaat cgttgacgag tgccgcaacg      1140
     cggcaggaag agcttcgggt cgccctcgac gcctggggga ttacgaaatg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page