(data stored in ACNUC7421 zone)

EMBL: CP001022.PE425

CP001022.PE425       Location/Qualifiers
FT   CDS_pept        449306..450475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0431"
FT                   /product="5-methylthioribose kinase"
FT                   /EC_number="2.7.1.100"
FT                   /note="KEGG: bsu:BSU13560 methylthioribose kinase; TIGRFAM:
FT                   5-methylthioribose kinase; PFAM: protein of unknown
FT                   function DUF227"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59913"
FT                   /db_xref="GOA:B1YIY3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY3"
FT                   /protein_id="ACB59913.1"
FT                   /translation="MGYQAFTVQDAIERVRTLGLIGNEPVTAEEIGDGNLNLVFRIQAG
FT                   EKRLILKQALPYAKVVGESWPLSLERAWIEQSALKEFAKVAVPFVPHVYHASKEEAFTV
FT                   MEDLSHLTIVRGGLLEGEKYPLLAEHIGSYLARTLFYTSDFAVGPVAKKQIARQYYNPD
FT                   LCDITEKLIFTDPFYDAETNAIEAGLEAEVDRIWNDAELKREVAKLEALFITKGDALLH
FT                   GDLHTGSIFASAEETKVIDPEFAFYGPFGFDVGQFIAHLFFAAYPDYDRLRDERIKDID
FT                   TFWLTFASTFKALWEREAVEPFRKADGLVDDVLSTILQDALGFAGCELIRRTIGLALVA
FT                   DLEQISDSTVRLERKRHALRLGAALIKRRTECKTFTDLRNFDVTEELSR"
     atgggatatc aagcatttac agtacaggac gcgattgaac gggtccggac actcggattg        60
     atcggcaatg aaccggtgac ggcagaggaa atcggagatg gaaatttaaa tctcgttttc       120
     cggattcagg caggggaaaa acggctgatt ttaaagcagg cgttacctta tgcaaaagtc       180
     gtcggggaaa gctggccgct gtcgctcgaa cgggcctgga ttgaacaatc ggccttaaaa       240
     gaattcgcga aagtcgccgt tccgtttgtc ccgcatgtct accatgcgag taaagaagaa       300
     gcgttcacgg tgatggaaga cttgtcacat ctgacaatcg tccggggtgg actgcttgaa       360
     ggggaaaagt atccgttgct cgcggaacac atcggttcgt atttggcgcg gacactgttt       420
     tatacgtcgg attttgccgt cggaccggtc gcgaaaaaac agattgcccg tcagtactac       480
     aatccggatc tgtgcgatat cacggaaaaa ctaatcttca cggatccgtt ttatgatgca       540
     gaaacgaatg cgattgaagc aggtctcgaa gcggaagttg accggatttg gaacgacgcg       600
     gaactgaaac gggaagtcgc gaagcttgaa gccttgttca tcacgaaggg cgacgcattg       660
     ttgcacggcg acttacatac aggcagtatt tttgcctcgg cggaagaaac gaaagtcatc       720
     gatcccgaat ttgcgtttta tggaccgttc ggatttgatg tcggtcaatt tatcgcacat       780
     ctgttttttg ccgcgtatcc ggactatgac cggttgcggg atgagcggat caaggatatc       840
     gatacattct ggctgacgtt tgcttcgacg ttcaaagcgt tatgggaacg ggaagcggtc       900
     gagccgttcc ggaaggcaga cggactggtc gatgatgttc ttagcacgat tttacaggac       960
     gcactcggat ttgccggttg tgaactgatt cgccggacga ttggattggc attagttgca      1020
     gacttggagc aaatttcgga ttcgaccgtt cgccttgaac gaaaacgcca tgcattgcgg      1080
     cttggtgctg ctttgattaa acgccggacg gaatgcaaga cgtttaccga tctgcggaat      1140
     tttgacgtga cggaggaact cagccgatga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page