(data stored in ACNUC7421 zone)

EMBL: CP001022.PE426

CP001022.PE426       Location/Qualifiers
FT   CDS_pept        450472..451518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0432"
FT                   /product="translation initiation factor, aIF-2BI family"
FT                   /EC_number="5.3.1.23"
FT                   /note="KEGG: gtn:GTNG_0837 methylthioribose salvage
FT                   protein; TIGRFAM: translation initiation factor, aIF-2BI
FT                   family; eIF-2B alpha/beta/delta-related uncharacterized
FT                   protein; PFAM: initiation factor 2B related"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59914"
FT                   /db_xref="GOA:B1YIY4"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY4"
FT                   /protein_id="ACB59914.1"
FT                   /translation="MSQFVQSIIYENRTVTILDQTRLPEEEHYEIIHDLAQAIDAIKQL
FT                   RVRGAPAISLFGGFVLVQEAFRTTGTLAEAKQELLEVSAQLLATRPTAVNLRNVLDELN
FT                   QLIVSATTLKELPVRLEQKALELYQTDAKTSRQIGVHALELFESGDRVLTICNAGSIAT
FT                   AAYGTALAPFYLAKEQGIPLSVYASETRPLLQGARLTTWELQRAGIDVTLITDNMVAHT
FT                   IKEKQITAIIVGADRITRNGDTANKIGTFQLALLARAFGIPFYVAAPLSTFDFTSLSGD
FT                   EIEIEERDAREVTQLAGKATAPAGVPVFNPAFDVTPHDLITAIITELGVIEHPDVETIK
FT                   RTIGQHTH"
     atgagccaat tcgttcagag catcatctat gaaaaccgga cggtgacaat tttggatcag        60
     acccgtcttc cggaagaaga acattatgaa atcatccatg acttggcgca ggcgattgac       120
     gccatcaaac aattgcgagt ccgtggtgca ccggccatca gtctgttcgg cggattcgtc       180
     ctcgttcagg aagcgtttcg gacgacaggg acgctggctg aagcaaaaca ggagttgttg       240
     gaggtgtcgg cacaattact cgcgacccgt ccgacggccg tcaatctgcg aaatgtcctc       300
     gatgagctga atcagctgat tgtttccgct acgacgctga aagaactgcc ggtacgtctc       360
     gaacaaaagg cattggaact ttatcagacg gatgccaaaa catcccgtca aatcggggtt       420
     catgcactgg aattgttcga gtccggtgac cgggtactaa cgatttgtaa tgccggatca       480
     attgcgacgg cagcttacgg aacggcgctc gctccgtttt atctcgccaa ggagcaaggc       540
     atcccgttat ccgtctatgc gtcggaaaca cggcctttgt tgcagggtgc acgtttgacg       600
     acatgggagt tgcaacgggc agggattgac gtcaccttga tcacggacaa tatggtcgcg       660
     catacgatca aggaaaagca gatcaccgcc atcatcgtcg gagcggaccg gattacccgg       720
     aacggggata cggccaataa aatcgggacg tttcagctgg cattactcgc acgtgccttc       780
     ggaattccgt tttacgtcgc cgcaccgctg tcgacgtttg actttacaag tctgtcagga       840
     gatgaaatcg agattgaaga acgcgacgcc cgtgaagtga cacagcttgc cggaaaagcg       900
     acggcaccgg ccggcgtacc ggtctttaat ccggcgtttg acgtgacgcc gcacgacctt       960
     atcaccgcca tcattacgga gctcggagtc attgaacacc cggatgtgga gacaatcaaa      1020
     cggacaatcg gacaacatac acactaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page