(data stored in ACNUC7421 zone)

EMBL: CP001022.PE43

CP001022.PE43        Location/Qualifiers
FT   CDS_pept        59403..62918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0044"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: bcy:Bcer98_0048 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: helicase domain protein; transcription factor CarD;
FT                   TRCF domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59531"
FT                   /db_xref="GOA:B1YGP8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGP8"
FT                   /protein_id="ACB59531.1"
FT                   /translation="MKQLQNLLLGIPEIKTVRERFRDGVNAQLITGLMNSGKALFIAGI
FT                   YQETKKRFVIVTHNMFQAQKLYDDLIELVPEQDVMLYPVDETLAAELSYGASPELRATR
FT                   IETRHRLLTTDDGILIIPLVGLRRYVPTASDFLDHTKRIKPGDVLSIPDFIQELVDAGY
FT                   ERTATVTTPGEFAVRGSIIDLYPLTVERPYRLDLFDEEVDSIYTFDAETQRSLGVIAEA
FT                   LVPPATEHFATREGLKTAGDKLRRLYDATKERVQSTEVLAALEEGIAYDVEVLEGGDRP
FT                   KQLAKYAPLLYETTLLDDIKDAVLIVDEVARIEEAAEVQDTEEAEWMASLIERGQSVSD
FT                   YTLSVPMLNVFKQRQLLYLSLLPTRRSGVPESAAIHFSIKPIAPFHGQMERLKQEVDRY
FT                   GRADMWMVFLASNRERAERMRQTLSDYGVEASLHTTEDEIRRGHPSILIGGIHGGFEMT
FT                   NARLVVITEEEVFKQPARRRKQTTKLTNAERIKSYQELKTGDYVVHIHHGIGRYHGIKT
FT                   IDVAGNHQDYLHLIYAGEDSLYVPVDQIDLIQKYVGAEGKEPKIYKLGGMEWKKVKAKV
FT                   QKSVEDIADELIKLYAAREAAVGFAFPEDDDSTQAFEASFPYEETVDQLRSIEEIKKDM
FT                   ERPRPMDRLLCGDVGYGKTEVAIRAAFKAVMAGKQVALLVPTTVLAQQHYETMLERFSD
FT                   WPINVSVMSRFRSAAELKATKKGLKEGTIDVVVGTHRVLSKDVQFADVGLLIIDEEQRF
FT                   GVKHKERLKQLKTNVDVLTLTATPIPRTLHMSMIGIRDLSVLETPPENRYPVQTYVMEY
FT                   DGIVMREALERELGRGGQAFFLYNRVEGIERKAEEIRALVPEARVVTAHGRMTETELES
FT                   QLIAFFEGDADVLVSTTIIETGIDIPNVNTLIVNDADQMGLSQLYQLRGRVGRSSRVAY
FT                   SYFTYRPQKRLTEVAESRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGSQQSGFIDSV
FT                   GFDLYSQMLSEAVEERKERMKGRKKVQKFVPDFTFSLDAYIPSHYMADSELKIEFYKRL
FT                   KYVDTPESLESLETEMLERFGEFPTEVARLIQLTRMRIFAERARVERVKQTDPKIEIVL
FT                   SEQTTQTLDVADFVKWTVPIGRGLGMGQEEGKLVLTLNRGKQTVQQMTEQAERLLAEID
FT                   RRIVQ"
     atgaaacaac tacaaaatct gttactcggt attccggaga tcaaaaccgt ccgggaacgg        60
     ttccgcgacg gggtcaatgc ccaactgatc acgggcctga tgaatagcgg gaaagcgtta       120
     ttcatcgctg gcatttacca agagacgaaa aaacgattcg tcatcgtgac tcataacatg       180
     ttccaggctc aaaaattata tgatgattta attgaacttg ttcccgagca ggacgtgatg       240
     ttgtatccgg tcgacgaaac gcttgccgct gaattatcat acggcgcaag ccccgaactt       300
     cgggcaaccc gaatcgagac ccgtcatcgt ctgttgacga cggacgacgg tattttaatc       360
     attccgcttg tcggtctgag acgatatgtt ccgacggcat ctgacttttt agatcatacg       420
     aaacggatca aaccggggga tgtcttatcg attccggact tcattcagga attggtcgat       480
     gccggatacg aacggacagc gacggtgacg acgcccggag aattcgcggt ccgcggaagc       540
     atcatcgatc tatatccgtt gactgtcgaa cgtccttatc ggctcgactt atttgatgaa       600
     gaagtcgatt cgatttatac attcgatgcc gagacccaac gttcacttgg tgtcatcgca       660
     gaagcgttag tgcctccggc gacggaacat tttgcaacac gcgaaggatt gaagacggcg       720
     ggtgacaagt tacgccgtct gtatgatgcg acgaaggaac gggttcaaag tacggaagta       780
     ttggctgccc ttgaagaagg aattgcctat gacgtcgaag tgcttgaagg cggggaccgt       840
     ccgaaacaac tcgcgaagta tgcgccgctt ttatatgaaa cgacgttgct tgacgatatt       900
     aaggatgctg ttttgattgt ggatgaagtg gcccggattg aagaagcggc cgaagtgcag       960
     gatacagaag aagcggaatg gatggcttcg ttgatcgaac ggggacaaag tgtcagtgac      1020
     tatacgttat cggttccgat gctgaatgtg ttcaagcaac ggcaattgct ttatttatcg      1080
     ttgcttccga cacggcgtag cggtgtgccg gaaagtgcgg cgattcattt cagtattaag      1140
     ccgattgctc cgttccatgg acagatggaa cgattgaaac aggaagtcga ccggtatggt      1200
     cgggcggata tgtggatggt ctttctggca agcaaccggg aacgggcgga acgcatgcgg      1260
     cagacgttat ccgattacgg ggtcgaagcg tctctgcata cgacggaaga tgaaatccgt      1320
     cgcggacatc cgtccatctt aatcggcggt attcatggcg gatttgagat gacaaacgcc      1380
     cgtcttgtcg tcatcacgga agaagaagtc tttaaacagc cggcacgacg acggaaacaa      1440
     acgacgaaac tgacgaatgc cgaacgaatc aaaagttatc aggaactgaa gaccggtgat      1500
     tacgtcgtcc atatccatca cggaatcggt cgttatcacg gcatcaagac gattgatgtc      1560
     gccggcaatc accaagacta cctgcatttg atttatgccg gtgaggattc cctgtatgtc      1620
     ccggtcgatc aaatcgactt aatccagaag tatgtcgggg cggaagggaa agagccgaag      1680
     atttacaaac tgggtgggat ggaatggaag aaggtcaagg cgaaggttca aaaatccgtc      1740
     gaggatatcg cggatgaact gattaagctg tacgcggcac gtgaagcggc cgtcggcttt      1800
     gccttccccg aggatgatga cagtacacag gcttttgaag catccttccc ttacgaggaa      1860
     accgtcgacc aactccggtc gatcgaagaa atcaaaaaag acatggagcg cccgcgtccg      1920
     atggatcgtc tgttatgcgg ggatgtcggt tacgggaaaa cggaagttgc cattcgggct      1980
     gcctttaaag cagtcatggc aggcaaacag gtcgcactgc tcgttccgac gacggttctc      2040
     gcccaacagc attatgaaac gatgctcgaa cgcttcagtg actggccgat taacgtctcc      2100
     gtcatgagtc gtttccgctc ggcagcggaa ctgaaagcca cgaaaaaggg cttgaaggaa      2160
     ggaacaattg atgtcgtcgt cggcacccat cgtgtcctgt ccaaagatgt ccagtttgcc      2220
     gacgtcgggt tgctgattat tgatgaagaa caacgttttg gtgttaagca taaagaacgg      2280
     ttgaagcagt tgaagacgaa tgtcgatgtg ctgacactga cggcgacccc gattccacgg      2340
     acgctgcata tgtcgatgat cgggatccgt gatttatcag tcctcgagac accgccggaa      2400
     aatcgttatc cggtccagac gtatgtcatg gagtatgacg gaatcgtcat gcgcgaagca      2460
     ctcgaacgtg aacttggacg gggtggacaa gccttctttc tctataaccg tgtcgaagga      2520
     atcgaacgga aagcggaaga aatccgggct ctcgttccgg aagcacgtgt tgtcactgcc      2580
     cacgggcgga tgacggaaac agaacttgaa agtcagttga ttgctttctt cgaaggggat      2640
     gcggacgtcc tggtcagtac gacaatcatt gagacgggaa ttgacattcc gaacgtcaat      2700
     acgttgattg tcaacgatgc cgatcagatg ggtctgtcgc agttgtatca attacgcggt      2760
     cgggtgggcc ggtcgagtcg tgtcgcctat tcctacttca cgtaccgtcc gcaaaaacga      2820
     ttgacggaag tcgcggagag ccgtctgcaa gcgatcaagg aattcacgga actcggaagc      2880
     ggatttaaga ttgcgatgcg cgatttatcg atacgcggtg ccggaaactt actcggctca      2940
     caacaatctg gtttcatcga ttctgtcgga tttgatttgt actcacaaat gctgtcggaa      3000
     gcggtcgaag aacggaaaga acggatgaag ggcagaaaaa aagttcagaa attcgttccg      3060
     gacttcacgt tcagcctcga tgcctatatt ccaagccact atatggcgga ctcggaactc      3120
     aaaatcgagt tctacaaacg tttgaagtat gtcgatacac cggaaagcct ggaatcactg      3180
     gaaacggaaa tgttggagcg tttcggagaa ttcccgactg aagtcgcacg gttgattcaa      3240
     ttgacacgaa tgcgaatctt tgccgaacgg gcacgggtcg aacgggtcaa acaaacagat      3300
     ccgaaaatcg aaatcgtctt gtctgaacag acgacacaaa cgttggatgt agcggatttc      3360
     gtgaaatgga ccgttccgat cggacgtggt cttggtatgg ggcaggaaga aggaaagctg      3420
     gtattgacac taaaccgcgg caaacaaacc gtacaacaga tgacagagca agccgaacgg      3480
     ttactggctg agattgaccg ccggatcgta caatga                                3516
//

If you have problems or comments...

PBIL Back to PBIL home page