(data stored in ACNUC7421 zone)

EMBL: CP001022.PE431

CP001022.PE431       Location/Qualifiers
FT   CDS_pept        456471..457553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0437"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   bpu:BPUM_0546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59919"
FT                   /db_xref="GOA:B1YIY9"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIY9"
FT                   /protein_id="ACB59919.1"
FT                   /translation="MTKWQIGWRYAVLLITVTALWIYARIDGGNVASLLVYIMAGLTVY
FT                   WTLFLIWPVTQAIATREVSNKMLIAGTDLPVSLRVRRKYPFLIGAVDVTEAVPDTLSEE
FT                   PLDIRHPLRAHYRKVEHIDYLIPSIRRGLYQIPGCVLEIRDPFGLFMRKKLYPVETYLA
FT                   VEPARLAVQLPHEDDRGDGGISPVSLDLRQSSFTVVGVREYVSGDRMNQIDWKSTAKRQ
FT                   GLMTKTFEREQERETTIVFNEGTVSDENFEKSISMLAAATDQLNKRHLNYRIHLVGHGV
FT                   QSLSLPLEGAKLTHYLMTAQPSRTRSFIESWEYSSKALRLSGNVLFITPDLESNNEMWI
FT                   SKIRQEASVHVYTPERRTTG"
     atgacaaaat ggcaaatcgg ttggcgttac gccgtcttgc tgattacagt cacagctctg        60
     tggatctatg cccggattga cggcggaaac gtcgcttcac tgttggttta tatcatggca       120
     gggttaaccg tctactggac gctgtttttg atctggccgg tcacacaagc aatcgcgacg       180
     cgggaagttt caaataagat gttgattgcc ggaaccgatc ttccggtttc acttcgagtc       240
     cggcggaaat atccgtttct catcggtgcc gtcgatgtca cggaagccgt tccggacaca       300
     ctcagtgaag aaccgctcga tatccggcat ccgctccggg cacattaccg gaaagtcgag       360
     cacatcgatt atctgattcc ttccatccgc cggggactgt atcaaattcc cggctgtgtg       420
     ctcgaaatcc gtgatccgtt cggcttgttc atgcggaaaa aactctatcc ggtcgaaacg       480
     tatctggccg tcgaaccggc ccggttagcg gtccaactgc cgcatgaaga cgatcgcggc       540
     gacggcggga tttctcccgt ttcactggat ctccggcaat cctcctttac ggtcgtcggt       600
     gtccgtgagt acgtcagcgg agaccggatg aatcagattg actggaaatc aaccgcgaaa       660
     cgccaaggat tgatgacgaa aacgtttgag cgggaacagg aacgcgagac gacaatcgtc       720
     tttaacgaag gaaccgtcag cgatgagaac ttcgaaaaaa gtatttccat gctggctgcc       780
     gcaacggatc aattgaataa acgtcatctg aattaccgga ttcatcttgt cggacatggc       840
     gtccagtcgt tatcgttgcc gcttgaaggc gcaaaactga cgcattacct gatgacggcg       900
     caaccgagcc ggacccggtc gttcattgaa tcctgggaat attcttcaaa agcgttacga       960
     ctgagcggaa atgtcctgtt catcacaccg gaccttgaat ccaacaatga aatgtggatt      1020
     tcgaaaatcc ggcaggaagc aagcgttcat gtctatacac cagagaggag gacgaccgga      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page