(data stored in ACNUC7421 zone)

EMBL: CP001022.PE432

CP001022.PE432       Location/Qualifiers
FT   CDS_pept        457550..459622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0438"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   oih:OB0715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59920"
FT                   /db_xref="GOA:B1YIZ0"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ0"
FT                   /protein_id="ACB59920.1"
FT                   /translation="MMRRLIWNLLAGLLFASFMPPLLELTTFESVIPFLPLLLTPLLLS
FT                   HVRRSWFLLGSLLALLVSFYLILIPGEAPWNLFREIAGDINRVINGELPGRPAFAFSIG
FT                   LISFLIGYLARRTFPNRGFVFGLALGVIGFIAYCDTWTDYSGEQFIIYPIVLALFLLYA
FT                   TEVSERPMASYVRPFSALLIIGATVVAAVQSPVITATWQDSWYDWTDGFESEGTSSSQI
FT                   QKVGYGNNDEQLGGPFQMDDREVFQVESEGSRYWRVETKDVYTGKGWVLSKSEPEIDSR
FT                   GFFSHFGDDVKKREERATFELSRELPFVPYNGDNVRLSVDKQRQNLLIDPENQKVSYLD
FT                   DAERQQNYQIQYTYPLFTEELLQTDEPITLSEMEQDRYLQLPDTLPNRVRDLAEEIVAD
FT                   EDSPWDKAKAIESYFEQENFEYNTEEVAVPEENQDYVDQFLFETKLGYCDNFSTSATVL
FT                   LRAVGLPARWVKGFTGGESDVIGAAVTSYTVRNKNAHSWVEVYIEGPGWVPLEPTVSFD
FT                   GAGQYTIDQETNNETEQANPQRDTETDTETATPERPQENLLDEEQTTTAAQTEQQSFPI
FT                   WPVVGVIVGLVFLYLFRKPLTRTAAILFFRNQLHRPEGFKRMYRFLLRRLDKQGFHYKD
FT                   GRTLTELAHEVDGYYETYAMRPLTDAYERMVYGGESLSVDKKREYFENIIRRIEG"
     atgatgcgac gactgatttg gaatctgctc gccgggctgc tgttcgcgag tttcatgccg        60
     ccgctgcttg agctgacgac gtttgagagt gtcattccgt ttctgccgct tctgttgaca       120
     ccacttttgc tgtcgcatgt ccgacgcagc tggtttttac tcggcagttt actggcattg       180
     ctcgtttcgt tctatttgat tttgattccc ggcgaagcac cgtggaacct gttccgtgaa       240
     attgccggtg acatcaaccg tgtcatcaac ggggagttac cgggacgtcc ggcatttgcg       300
     ttctcgattg gactgatcag ttttctgatt ggttatctgg cgcggcggac gtttccaaac       360
     cgcggattcg tcttcggact ggcgcttggt gtcatcgggt tcattgccta ttgcgacacg       420
     tggacggatt actcgggcga acagttcatc atctacccga ttgtgctggc tctgtttttg       480
     ttatatgcga cagaagtcag tgaacggccg atggcatcgt atgtccgtcc gttcagcgcc       540
     ttgctgatca ttggagcgac ggtggttgcc gcagttcaga gtcccgtcat cacggcgaca       600
     tggcaagaca gctggtacga ctggacggac ggttttgaaa gtgaaggcac gtcgtcgagc       660
     cagatccaaa aagtcggata cggcaacaac gacgagcaac tcggcggtcc gttccaaatg       720
     gacgaccggg aagtcttcca ggttgaaagt gaaggcagcc gctactggcg tgtcgagaca       780
     aaagacgtct ataccggaaa aggctgggtc ctgtcgaaat cagaaccgga aattgattcg       840
     cggggatttt tctcgcactt cggagatgat gtcaagaaac gggaagaacg ggcgacattt       900
     gaactgtcac gggagctgcc ttttgtgccg tataacgggg acaatgtccg tttgagtgtc       960
     gataagcaac ggcaaaatct gttgattgat ccggaaaatc aaaaggtctc gtacctggat      1020
     gatgcggaac gccagcaaaa ttatcagatt caatacacgt atccgttgtt tacggaagaa      1080
     ttgctccaga cggatgagcc gattacattg tcggagatgg agcaggaccg gtatttacag      1140
     ttaccggata cgttaccgaa tcgtgtccga gatctcgcgg aagagatcgt cgcggacgaa      1200
     gacagtccgt gggacaaagc gaaggcgatc gaaagttatt ttgagcagga aaacttcgaa      1260
     tacaatacgg aagaagtcgc cgtaccggaa gaaaatcagg attatgtcga tcaattttta      1320
     tttgagacga aactcggcta ctgtgataat ttttcgacgt ccgcgaccgt gttattacgc      1380
     gctgtcggtt tgccggcccg ctgggtaaaa ggatttacgg gcggcgaatc ggatgtcatc      1440
     ggggcagccg tgacgagtta tacggtccgc aataaaaatg cccactcgtg ggtcgaagtc      1500
     tatatcgaag gaccgggttg ggtaccgctc gaaccgaccg tcagttttga cggagccgga      1560
     caatatacga ttgatcagga aacgaataat gagaccgaac aagcgaatcc gcaacgcgat      1620
     acggagaccg atacggaaac cgcaacaccg gaacgtccgc aggagaatct gctggatgaa      1680
     gaacaaacga cgacagcagc gcagaccgaa caacaatcgt ttccgatttg gccggttgtc      1740
     ggtgtaatcg tcggactggt attcttgtat ctgttccgga aaccgttgac ccggaccgcg      1800
     gcgattttat ttttccgcaa ccagcttcat cgtccggaag gattcaagcg gatgtaccgt      1860
     ttcttattgc gccgtctcga caaacaaggc ttccactaca aggacggccg gacactgacg      1920
     gaacttgcgc atgaggttga cggatattac gaaacgtatg cgatgcgtcc gttgacggat      1980
     gcctatgaac ggatggtcta cggaggcgaa tcgttatcgg ttgataaaaa acgtgaatat      2040
     ttcgaaaata tcattcgacg gatagagggt tga                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page