(data stored in ACNUC7421 zone)

EMBL: CP001022.PE433

CP001022.PE433       Location/Qualifiers
FT   CDS_pept        459867..461411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0439"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; ExsB family protein; KEGG:
FT                   bha:BH0607 bifunctional GMP synthase/glutamine
FT                   amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59921"
FT                   /db_xref="GOA:B1YIZ1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIZ1"
FT                   /protein_id="ACB59921.1"
FT                   /translation="MEAHLDQEMILVLDFGGQYNQLITRRIRDLGVYSELHSHKITAAE
FT                   VKDIAPAGIIFSGGPRSVYAEDAYRCDPEIFDLGIPIFGICYGMQLMSQHFGGTVERAG
FT                   HREYGKATLTLNDPSPMYANLPLEQTVWMSHSDLVTSVPNGFVVDGTNVSCPIASIKNE
FT                   ELKMYGVQYHPEVNHTMFGKELLKNFLFEVCQCTGDWSMENFIEIEIAKIKEEVGDKKV
FT                   LCALSGGVDSSVVAALIHAAIGDQLTCMFVDHGLLRKGEAESVMKTFADHFHMNVIKID
FT                   AQDRFLNKLKGISDPEQKRKIIGNEFVYVFDEEASKLTDMDFLAQGTLYTDIIESGTDT
FT                   AQTIKSHHNVGGLPEDMQFKLIEPINTLFKDEVRELGKELGLSDEIVWRQPFPGPGLGI
FT                   RVLGEITDEKLEIVRESDFILRDEIKKAGLEREIWQYFTVLPPLRSVGVMGDERTYDYA
FT                   VGIRAVTSIDGMTSDWARIPWDVLEKISVRIVNEVQNVNRVLYDVTSKPPSTIEWE"
     ttggaagcac atttggacca agaaatgatc ctcgtcctcg actttggagg tcagtacaat        60
     caattgatca cacgccgcat tcgtgatctc ggagtttaca gtgaactgca ttcgcataag       120
     atcactgcag cggaagtaaa agacatcgca ccagccggta tcatcttctc cgggggacca       180
     cggagtgtct acgcagaaga cgcgtaccgc tgtgatccag aaatctttga cctcggcatt       240
     ccgattttcg gaatttgtta cggtatgcaa ttgatgtcgc aacactttgg tggaacggtt       300
     gaacgcgccg gacaccgcga gtacggaaaa gcgacgttga cactcaacga tccatcgccg       360
     atgtatgcga acctcccgct cgaacagacg gtttggatga gccacagtga cctcgtcaca       420
     tcggtaccaa acggtttcgt cgtcgatgga acaaatgtct cgtgcccaat tgcttcaatc       480
     aaaaacgaag agctaaagat gtacggcgtc cagtatcatc cggaagtcaa ccatacgatg       540
     ttcggtaaag aactcttgaa aaacttcctc ttcgaagtct gtcagtgtac gggcgactgg       600
     tcgatggaaa acttcatcga aatcgaaatc gcaaaaatta aagaagaagt cggcgataaa       660
     aaggtccttt gcgccctttc aggcggtgtt gattcatctg tcgtcgcggc actcattcac       720
     gcagcaatcg gtgaccagtt gacatgtatg ttcgtcgacc acggtctctt gcgtaaaggg       780
     gaagccgaaa gtgtcatgaa aacatttgcg gatcacttcc acatgaacgt catcaagatt       840
     gacgcgcagg accgcttcct caacaagtta aaagggatct cggatccgga gcaaaaacga       900
     aaaatcatcg ggaacgaatt cgtttatgta ttcgacgaag aagcgtcgaa gctgacggat       960
     atggacttcc tggctcaagg aacgctttat acggatatca tcgaaagcgg aacagatacg      1020
     gcccaaacga ttaaatcaca ccacaacgtt ggtggattgc cagaagacat gcagttcaag      1080
     ttgatcgaac cgatcaacac gctgttcaag gacgaagtcc gcgaactcgg aaaagaactc      1140
     ggtttgtcgg acgaaatcgt ctggcgtcag ccgttcccgg gaccaggtct cgggatccgt      1200
     gtcctcggtg aaatcacaga cgagaaactt gaaatcgtcc gcgaatccga tttcatcctc      1260
     cgtgatgaaa tcaaaaaagc cggtcttgaa cgcgaaatct ggcagtactt cacagtcttg      1320
     ccgccacttc gttcagttgg tgtcatgggt gacgagcgga catacgacta tgccgtcgga      1380
     atccgtgccg ttacatcaat cgacgggatg acatcggact gggcacgcat cccgtgggac      1440
     gtgctcgaga agatttctgt ccggatcgtc aacgaagttc agaacgtcaa ccgcgtcctg      1500
     tacgatgtga cgtcgaaacc accttcaacg attgagtggg aataa                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page