(data stored in ACNUC7421 zone)

EMBL: CP001022.PE436

CP001022.PE436       Location/Qualifiers
FT   CDS_pept        463693..464562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0442"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: oih:OB3032
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59924"
FT                   /db_xref="GOA:B1YIZ4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ4"
FT                   /protein_id="ACB59924.1"
FT                   /translation="MNGRDRVYDHAKLILIFLVVLGHIIEPFISKSRGLEGIFNFIYLF
FT                   HMPAFIFISGYFTKGKLTFRTGLKLSLDYFVLFIMIQLVFVAVMKGIGIDQYQFLTVQP
FT                   AYIYWYLFAMFVWSLMLPAALWLGRSVKIGIGRVFLVSVLVALGAGYIDQIGWAWSLSR
FT                   IVVFFPFFVLGYYFKSRGWIIYQVFPNRWMALAVMLAGALMMWIWPDLFQFNLVSGANS
FT                   YAKIGLNDTGLIVRLVLYLTQWMMIMAFFTLLPKRPFVLSHLGTKTLTIYILHGFIVKG
FT                   LIATAYFN"
     atgaatggac gcgatcgggt ttacgatcat gccaaattaa tattgatttt tttagtggtt        60
     ttgggtcata taatcgagcc ctttatttca aaaagccgag gattggaagg tatatttaat       120
     tttatatatt tattccatat gccagccttc attttcatct ccggttattt tacaaagggg       180
     aagttaacgt ttagaaccgg cttgaaactc tctttggact atttcgtgtt attcatcatg       240
     atacaactgg tatttgtagc ggttatgaaa gggatcggaa ttgatcaata ccaattcttg       300
     acggtacaac ccgcttatat ttactggtat ctgtttgcga tgttcgtctg gagtctaatg       360
     ctgcccgctg ctctttggct ggggcgatcc gtcaagatcg gaatcggacg cgtttttttg       420
     gttagtgtac tggtcgcttt gggagccggc tacatcgacc aaatcggttg ggcatggagc       480
     ttatcacgca ttgtagtctt ttttccgttt tttgtgctcg gctattactt caagagtcgt       540
     ggatggatca tctatcaggt gttcccgaac cgctggatgg ctttagcggt catgctggct       600
     ggtgctctga tgatgtggat ttggccggat ctttttcagt ttaacttagt gagtggagca       660
     aattcgtatg cgaaaattgg attaaacgac actggtctaa tcgtacgact tgttctatat       720
     ctgactcagt ggatgatgat catggcattc tttaccttgt tgccgaaaag accattcgta       780
     ctttctcatc ttggaacaaa gacgctgacc atttacatac ttcatggatt tattgtgaaa       840
     ggactcattg ccactgctta ttttaactaa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page