(data stored in ACNUC7421 zone)

EMBL: CP001022.PE441

CP001022.PE441       Location/Qualifiers
FT   CDS_pept        474480..474971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0447"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: lwe:lwe1793 phosphoribosylaminoimidazole
FT                   carboxylase I; TIGRFAM: phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59929"
FT                   /db_xref="GOA:B1YIZ9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ9"
FT                   /protein_id="ACB59929.1"
FT                   /translation="MSKVEIGVIMGSQSDWVTMQKTCDVLDQLDIGYEKKVVSAHRTPD
FT                   LMFRYAESARERGLKVIIAGAGGAAHLPGMVAAKTTLPVIGVPIQSKALQGIDSLLSIV
FT                   QMPGGVPVATVAIGDAGAKNAGLLAAQILGTVDERIARALDHMRVELEGDVIASEVYLT
FT                   "
     atgagtaagg tagaaatcgg agtcatcatg ggcagccaat cggattgggt gaccatgcag        60
     aaaacgtgtg atgtactgga tcaattggac attggttatg aaaagaaagt tgtatcggca       120
     caccggacac ctgacttaat gtttcgatat gccgagtcag cccgggaacg agggctcaag       180
     gtcatcattg ccggggcagg cggagccgct catcttccgg gaatggttgc tgcgaagacg       240
     acattaccgg taatcggtgt cccaattcaa agcaaagcac ttcaaggcat cgattcctta       300
     ctctccattg tccaaatgcc cggtggtgtt ccagtcgcga cagttgcaat tggtgacgcc       360
     ggagccaaaa atgcgggttt acttgctgct cagattcttg gaacggttga cgaacggatt       420
     gcccgagctc ttgatcatat gcgtgtcgaa ctggaaggag acgtcatcgc ttccgaggtg       480
     tatctgacat ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page