(data stored in ACNUC7421 zone)

EMBL: CP001022.PE442

CP001022.PE442       Location/Qualifiers
FT   CDS_pept        474968..476071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0448"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bcz:BCZK0264 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59930"
FT                   /db_xref="GOA:B1YJ00"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ00"
FT                   /protein_id="ACB59930.1"
FT                   /translation="MKRVGILGGGQLGRMMALSARQMGYSLITLDPTENAPCAQVADQQ
FT                   IQAPFTDVEAAKRLAAESDVVTYEFENISHEVAEAIGYKLIHGTELLFRTQHRIREKEL
FT                   IEQLGYKVAPYQGVQTSEDLLGAKRQLGFPFVLKTARFGYDGKGQTVIRTELDLQTAMK
FT                   TFEATEYVAEKWLPFDQEISVIVMRSERETKVFPVSENIHQDNILHLSIVPARIPIDLE
FT                   QKAIELATRLANDVDLIGTLAIELFVVGSELIVNELAPRPHNSGHYSIDACETSQFEQH
FT                   IRAICGLPLGDTRLTTPVVMANILGQHITALDEALPMLSSRTKVHLYGKQDAKQGRKMG
FT                   HLNILADSVEEALAEVERLQIWKETVR"
     atgaaacggg ttggtatctt aggtggaggt caattaggtc ggatgatggc tttatctgca        60
     cgccaaatgg gctattcgct catcacactt gatccaactg aaaacgcacc gtgtgcgcaa       120
     gtagcggatc aacagattca agcaccgttc acggatgtcg aggccgcaaa gcgacttgct       180
     gctgaatcag acgtcgtgac ctatgagttt gagaatatct cacacgaagt agcggaagca       240
     atcggttata aactgattca cgggacagag cttttgtttc ggacccaaca ccggattcgg       300
     gagaaagaac tgattgaaca gcttggttac aaggtggcac cgtatcaggg agttcagaca       360
     agtgaagatc tccttggagc caaacggcag ttaggtttcc cattcgtctt gaaaacagcc       420
     cgctttggtt acgacgggaa aggccagacg gtcattcgga cagagctgga tttacaaaca       480
     gcgatgaaga cctttgaagc aaccgaatat gttgctgaaa aatggttacc gtttgatcag       540
     gagatttccg tcatcgtcat gcgaagcgag cgggaaacga aggtcttccc ggtcagtgaa       600
     aatatccatc aagacaacat tctgcatctg tcaatcgttc ccgcccgcat cccaatcgac       660
     ttggaacaaa aagcgattga actggcgaca cgtctcgcaa acgatgtcga tttgattggc       720
     acactggcaa tcgaactgtt cgtcgtcggc tccgaactga tcgtcaacga actggcgccg       780
     cgcccgcaca actcgggtca ttattcgatt gatgcgtgtg agacgtcaca gttcgagcag       840
     cacatccgcg ctatctgcgg actgccgctt ggcgacaccc gcttgacgac accggtcgtc       900
     atggcgaaca tcctaggtca gcatatcacg gcattagacg aggcattacc gatgttatcc       960
     tcgcggacga aagtccattt atacggaaaa caggacgcaa aacaggggcg gaagatgggg      1020
     catctgaaca tcttggctga ttcggtcgaa gaagcgttag ccgaagttga gcgcctgcag      1080
     atatggaagg agacggttag atga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page