(data stored in ACNUC7421 zone)

EMBL: CP001022.PE446

CP001022.PE446       Location/Qualifiers
FT   CDS_pept        478373..479056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0452"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: bha:BH0628 phosphoribosylformylglycinamidine
FT                   synthase subunit I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59934"
FT                   /db_xref="GOA:B1YJ04"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ04"
FT                   /protein_id="ACB59934.1"
FT                   /translation="MKFAVIVFPGSNCDLDMYHAVKDALGEEVEYVFHTETSLEGYDGV
FT                   LLPGGFSYGDYLRCGAIAQFSPIMEEVKRFAAEGKTVLGVCNGFQILVEAGLLPGVLHR
FT                   NTGLKFMCRTVELKVENNETRFTSDYAAQETITIPIAHGEGNYYCDDATYAMLQTNRQI
FT                   AFTYTDNPNGSRGDIAGITNKAGNVLGMMPHPERAVELLTGGTDGLKLFTSLVKQGAHH
FT                   VKTTV"
     atgaagtttg ccgttatcgt ttttcccgga tctaactgtg atctagatat gtatcatgct        60
     gtgaaagatg cgcttggtga agaagtggaa tacgtcttcc atacggaaac gtctctcgaa       120
     ggatatgacg gcgtcttgtt gccgggtggc ttttcttacg gggactatct ccggtgtgga       180
     gcgattgctc aattctcacc gatcatggaa gaggtaaaac gctttgcggc agaaggcaaa       240
     acggttctag gcgtctgcaa cgggttccag attcttgttg aagccggact tctcccgggt       300
     gtcttacacc gcaacacggg actgaagttc atgtgccgca cggttgaact gaaagtcgaa       360
     aacaacgaga cacgctttac atcagactat gctgcgcagg aaacgataac gattcccatt       420
     gcacacggag aaggcaacta ttactgtgat gacgccacat acgcgatgct acagacgaac       480
     cgtcaaattg cctttacgta tacggataac ccgaacggat cacgcggcga catcgccggc       540
     atcacgaaca aagccgggaa cgtcctcggc atgatgccgc acccagaacg ggcagtcgag       600
     ctactgaccg gcggaacgga tggacttaag ttattcactt cactcgtcaa acagggggca       660
     caccatgtta aaacaacagt ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page