(data stored in ACNUC7421 zone)

EMBL: CP001022.PE450

CP001022.PE450       Location/Qualifiers
FT   CDS_pept        483692..484267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0456"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: bcy:Bcer98_0276 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59938"
FT                   /db_xref="GOA:B1YJ08"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ08"
FT                   /protein_id="ACB59938.1"
FT                   /translation="MKIACFASGSGSNVEALFEAVETGRLQATIELVVCDQKQAKVIER
FT                   AQARGCDIFVFTAKDYPDKPSFEREIVAELERRGVERIILAGYMRLIGDVLLSHYAGRI
FT                   VNIHPSLLPAFPGKDAIGQAFRGGVKITGVTIHIVDEGMDTGPIIAQEAVRITEDMTRE
FT                   TLQQAIQQVEHRLYPQVIEEWMKEEANV"
     atgaagattg cctgttttgc ctcgggaagt ggcagtaatg tcgaagcttt attcgaagca        60
     gttgaaacag gacgtctgca ggctacgatt gaactcgtcg tctgtgatca aaaacaagca       120
     aaagtgattg aacgggctca ggcccgcggc tgtgatatct tcgtcttcac agccaaagac       180
     tacccggata aaccgtcgtt tgaacgggaa atcgttgcgg aactggagcg gcggggcgtg       240
     gaacggatta tcctagccgg atatatgcgc ttgatcggag acgtcctgct gtcgcattat       300
     gctggacgga tcgtcaacat ccacccgtcg ttgctcccgg catttccggg aaaagatgcg       360
     atcgggcaag catttcgtgg cggagtcaaa atcacaggtg ttacaattca tatagtcgat       420
     gaaggcatgg atacaggacc aatcatcgcc caagaagcgg ttcggattac agaggatatg       480
     acacgggaaa cgctccaaca agcgattcag caggtggagc atagattgta cccgcaagtc       540
     atcgaagagt ggatgaaaga ggaggcaaac gtatga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page