(data stored in ACNUC7421 zone)

EMBL: CP001022.PE454

CP001022.PE454       Location/Qualifiers
FT   CDS_pept        489084..489398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0460"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="TIGRFAM: TrpR like protein, YerC/YecD; PFAM: Trp
FT                   repressor; KEGG: bsu:BSU06580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59942"
FT                   /db_xref="GOA:B1YJ12"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ12"
FT                   /protein_id="ACB59942.1"
FT                   /translation="MQLDKLRGKELDQLFTAIMKMDSLEDCYTLFEDLATVNEIQALAQ
FT                   RLEVARQLREGNTYHKIEKATGASTATISRVKRCLNYGSGGYDLALARLGLVEEEVADN
FT                   "
     atgcaactcg ataaattgcg tggaaaagaa ctcgatcaat tatttacagc catcatgaag        60
     atggattcat tagaagattg ttataccctg tttgaagact tggcgacggt caatgaaatt       120
     caggccttgg cacaacgtct cgaagtcgcc cgtcagttac gggaaggcaa tacgtatcat       180
     aaaatcgaaa aggcgacagg tgcttcgaca gccacgattt cgcgtgtgaa acggtgcctg       240
     aactacggtt ccggcggcta cgacttggcg ctcgcacgat taggtctcgt agaggaggaa       300
     gtagcggata actaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page