(data stored in ACNUC7421 zone)

EMBL: CP001022.PE461

CP001022.PE461       Location/Qualifiers
FT   CDS_pept        496899..498077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0467"
FT                   /product="CamS sex pheromone cAM373 family protein"
FT                   /note="PFAM: CamS sex pheromone cAM373 family protein;
FT                   KEGG: bay:RBAM_007030 YerH"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59949"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ19"
FT                   /protein_id="ACB59949.1"
FT                   /translation="MKSKKIAALTLTSTLFLGACSFDLSQKSDTKEVITESEQGKEVQA
FT                   VVSPAIDTTDSYYRTVLPFRPSVARGMTQKRVSSRLELDEIETGLMRHSTQFFAPDKYY
FT                   YQEGQLLEADQIAQWLLRKGKAVDGVSDPNGLNPAYTTGKSYKEKNQKSPLILSHILEQ
FT                   DYMLEEDKKLELGGTSVALVLNSEYVFQDENYGPTYTVKLDEKKVIAEGKRMANELVKK
FT                   MRKTDGIKTTPIHVALYLQESEGSPVSGHYVSSAFIGRGNQISSNDWKNYDEKYYYYPS
FT                   GAATNDVRDDAAKFDLFKDRLEDYFPNYTGMMGEGFYQEGELKKLEIKIPVQFYGKAEL
FT                   VAFIQYVTYLLENRWEYNRNVPTTITVTNLNGDTEAMLFIEPDTKKPIVKIR"
     atgaaatcta aaaaaatagc agcgttgacg ttgacgagta cattattcct cggcgcgtgt        60
     tcgtttgatt tgtcacagaa aagcgataca aaagaagtca ttacagagag cgaacaagga       120
     aaagaagtcc aagccgtcgt cagtccggca attgatacaa ccgattccta ttatcggacc       180
     gtcttaccgt tccgaccgag tgtcgcccgc gggatgacac aaaagcgggt cagttcccgc       240
     ctggagctgg atgaaatcga gaccggcctg atgcgtcact ccactcaatt ttttgctcct       300
     gataaatact attatcaaga aggacaactg ctcgaggccg atcaaattgc ccagtggttg       360
     ttacgaaaag gaaaagccgt ggatggtgtc agtgatccga acggcttgaa ccctgcctat       420
     acgaccggaa agtcttacaa agaaaaaaac caaaagtctc ctttgattct atcgcacatt       480
     ttggaacagg actacatgtt ggaagaagat aaaaaactcg aactcggcgg gacatccgtc       540
     gctttagtct taaacagcga atatgttttc caggatgaaa actacggtcc gacctatacc       600
     gtgaaactcg acgagaaaaa agtcatcgca gaaggaaaac ggatggcaaa tgaattggtc       660
     aagaaaatgc ggaaaacgga cggtatcaaa acgacaccga tccacgtcgc cttgtatttg       720
     caggaaagtg aagggtcacc ggtttccgga cattatgtat cttccgcctt tatcgggcgc       780
     ggcaatcaga tcagttcgaa cgactggaag aactatgatg aaaaatatta ttactaccca       840
     tcgggtgccg cgacgaacga tgtccgtgat gatgccgcga agtttgattt gttcaaggac       900
     cgcctcgaag actatttccc gaactacacc ggtatgatgg gagaaggctt ttatcaggaa       960
     ggtgaactga agaagttgga aatcaagatt ccggttcagt tttacggaaa agcagaactc      1020
     gtagcgttca ttcaatatgt gacctacttg ctcgaaaatc gttgggaata caatcggaat      1080
     gtcccgacaa cgattaccgt cacgaacttg aacggcgata cggaagcgat gttattcatc      1140
     gagccggata cgaaaaaacc gattgtcaaa atccgttga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page