(data stored in ACNUC7421 zone)

EMBL: CP001022.PE470

CP001022.PE470       Location/Qualifiers
FT   CDS_pept        507542..510100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0476"
FT                   /product="protein of unknown function DUF470"
FT                   /note="PFAM: protein of unknown function DUF470; protein of
FT                   unknown function DUF471; protein of unknown function
FT                   DUF472; KEGG: bwe:BcerKBAB4_1388 protein of unknown
FT                   function DUF470"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59958"
FT                   /db_xref="GOA:B1YJ28"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ28"
FT                   /protein_id="ACB59958.1"
FT                   /translation="MRFNKQRVLTVAKIILPIILIAFIFYQGQNELRSLSLKESIRAIQ
FT                   QIPSWKFILLIVSGLAAVATMFFYDFFLLRSLQVKVPIGLIFRASWIANSFNGIIGFGG
FT                   LAGMGVRTALYRPFVEGTRLLKAIGWMAPTLISGLSILSALSLLNVFPAFEVLDLKKWL
FT                   WPVIIGVAFFFPVYLLFTFRRGSSSIRPSSIALYSLVSLAEWFSAGVVVYFILAALGTD
FT                   VSFSKVIGVFIIAATAGLISMVPGGFGSFDLVFLIGMQRAGVEEGIVLTGLLIYRLVYY
FT                   LIPFVIGVIFSAREFSGPVVKMIEDKPIVGPSVEVGGVIWRLQLRFLSKVRHFTLALIT
FT                   LLAGIAIWGLAILPPNSTQYEYLEARLPHELLLLANSFFLMAGLLYVLLAPSLYRRTKR
FT                   SLYMIYGVSAFALIGMALRGFNLISLSVVLIVLVLVTMSRSAFHRERTLITTTRLIRAA
FT                   FAGFLYLGGFIFFGYAFYTLGSADGTKVYPAHEIFMFAASAAIFALVYTLVFIRLFNTF
FT                   NQPVLGEKLDMQKVKDVLTEEGGNYLSHLAFLGDKRFFFSESGRSFIQFSQTGNRIMML
FT                   GDPSGNPEEHSQLIACFLRRVEDLGYIPNIYQIQAQNMSLYHDFGFNFFKLGEEAIVDM
FT                   TTFTVSGKKRAGLRSIKNRFEREGMTFEVVSPPFSEALLDQLRDVSDEWLGGKSEKGFS
FT                   LGYFNESYLNQAPIGIMRDANQQMLGFMTFMPAYQEGVLSIDLMRFRPDGPNGIMDAMF
FT                   IRLFDYATEQGYHTFNMGMAPLSSVGEDETSFWQERVAADVFNNIRYMYSFTGLRRYKE
FT                   KYDPKWEGRYLAYRKRQSLTIAILKATRLISKKKDRILLP"
     atgagattca ataaacaacg tgtgttgaca gtggcgaaaa tcattttgcc gattatcttg        60
     attgcattca ttttttatca gggtcaaaac gaattaagaa gtctgtcgtt aaaggaatcg       120
     attcgggcga ttcagcaaat tccgtcctgg aagtttattt tattgattgt atcggggctt       180
     gcagcggtcg cgacgatgtt cttttatgat ttcttcttat tgcgttcgct tcaagtgaag       240
     gttccgatcg gattgatttt ccgggcatcc tggattgcca actcgtttaa cggcatcatc       300
     ggtttcggcg gacttgccgg aatgggcgtc agaaccgccc tttatcgacc gttcgtcgaa       360
     ggaacccggt tattgaaagc catcggttgg atggcaccga cactgatcag cggattatcg       420
     attttatcgg cattatcctt attaaatgtc tttccggcgt ttgaagtgtt ggatttaaag       480
     aaatggttat ggccggtcat catcggtgtt gccttcttct tcccggtcta tctgttgttt       540
     actttccgac gggggagcag cagtatccgt ccgtcgtcga tcgccctcta ttcgcttgta       600
     tcgcttgcgg aatggttcag tgcgggagtc gtcgtctatt ttattttggc ggccctcggg       660
     acggatgtca gtttttctaa agtcatcggc gtcttcatca tcgccgcgac agccggtctg       720
     atttcgatgg taccgggtgg attcggttcg ttcgacttgg tctttttgat cggtatgcag       780
     cgtgccggcg tcgaagaagg gattgtcctt accggattgt tgatttatcg tcttgtgtat       840
     tatttgattc cattcgtgat cggagtcatt ttctcggcac gtgagttcag cggtccggtc       900
     gtcaaaatga ttgaggataa accgattgtc ggcccgtcgg ttgaagtcgg cggcgtcatc       960
     tggcggcttc agttacgttt tttaagtaaa gtccgacatt ttacattggc cttgattacg      1020
     ttactcgctg gcatcgcgat ttggggtctg gcgattttgc cgccaaactc gacacagtat      1080
     gaatatttgg aagcccgtct gccgcatgag ttgttgttgc ttgcgaacag tttctttttg      1140
     atggccggct tgttgtatgt cctgcttgcc ccgtctctgt accgacggac gaagcgttca      1200
     ctgtatatga tttatggtgt ttcggctttt gctttgatcg ggatggcact gcgcggattt      1260
     aacttgattt ccttgtctgt cgtgttgatc gtactggttt tagtgacgat gtcacgaagt      1320
     gcctttcatc gtgaacggac gctgatcacg acgactcgac tgatccgggc cgcttttgcc      1380
     ggttttttat acctcggtgg attcatcttt ttcggatacg ccttttacac actcggttcg      1440
     gctgacggga caaaggttta tcctgcccat gagatcttca tgtttgccgc gagtgcagcg      1500
     atttttgcac ttgtctacac actcgtcttc attcgtttgt tcaatacctt taatcagccg      1560
     gtcttgggtg aaaagttaga tatgcaaaaa gttaaggatg tcttgacgga agaaggggga      1620
     aattatttaa gtcacctggc ttttctcggc gataaacgct ttttcttctc cgaatccgga      1680
     cgttcattta ttcagttcag tcagaccgga aaccggatta tgatgcttgg tgatccgagc      1740
     ggaaatccgg aagagcattc ccagttgatt gcctgtttct tacggcgtgt cgaggattta      1800
     ggttatatcc cgaacatcta tcagattcag gcacagaaca tgtcgttgta tcatgatttc      1860
     ggctttaatt tctttaagct tggtgaagag gcgatcgtcg acatgacgac ctttaccgtt      1920
     tccgggaaaa aacgggccgg cttacgttcc attaaaaatc gttttgaacg ggaagggatg      1980
     acgtttgaag tcgtatcgcc tccgtttagt gaagcgttat tggatcaatt acgtgacgtc      2040
     tcggatgagt ggttgggagg gaaatccgaa aaaggatttt cattaggtta tttcaacgag      2100
     tcttatttga atcaagcgcc gatcggcatc atgcgtgatg ccaatcagca gatgctcggc      2160
     ttcatgacgt tcatgccggc ttatcaggaa ggtgttctct cgattgattt gatgcgtttt      2220
     cgtccggatg gtccgaacgg aatcatggat gccatgttca tccgtttgtt tgactatgca      2280
     actgagcaag gctaccacac ctttaatatg ggaatggctc cgctctcgtc cgttggtgag      2340
     gacgaaacct cattttggca ggaacgcgtg gcagcggatg tgttcaataa catccggtat      2400
     atgtacagct ttacaggact gagacgatac aaggaaaaat acgatccgaa atgggaagga      2460
     cgttacctcg cctaccgtaa acgccaatca ctgacgattg cgatcttaaa agcgacacgt      2520
     ctgatttcga agaaaaaaga ccggatttta ttgccgtga                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page