(data stored in ACNUC7421 zone)

EMBL: CP001022.PE479

CP001022.PE479       Location/Qualifiers
FT   CDS_pept        519099..520298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0485"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: sha:SH1518 aspartokinase II; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59967"
FT                   /db_xref="GOA:B1YJ37"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ37"
FT                   /protein_id="ACB59967.1"
FT                   /translation="MTTVLKFGGSSVATVEQIQSIANYLKNRTEQGEKLVVVVSAMGKM
FT                   TDSLIAQAQAITDRPERRELDRLLAIGEEQTISLLSIALNSLGIKALSQTGAQAGISTM
FT                   GLHTKSKIKQIDGELLRKKLETYDVIIVAGFQGVNELGDVTTLGRGGSDTTAVALAAVL
FT                   DKRCEIYTDVDGVYTADPRIHATAQPIPHISYDEMMEMSALGSKVMEMRSVELGKKYGV
FT                   HIFVGKTLESERGTWIMEATETMEQKAVTSVSVTKNVLTVSIKHVPQTNSAVADIFELL
FT                   SGRHVNIDMISQTTFDSDIFLSFSCPLDEEEFLEEALQDIINRFPTVKVDRHNQHAKLS
FT                   VVGIGMRDATGVASKLFATFRAENITFYQVTTSEISISYTIAQADIERTVAAIAKAFDL
FT                   "
     gtgacaactg tacttaaatt tggtggtagt tcggttgcga ctgtcgaaca gattcagtca        60
     attgcgaatt atttgaagaa tcggacggaa caaggggaaa aattagtcgt cgtcgtgtcg       120
     gcaatgggga aaatgaccga ttcattgatt gctcaggcgc aggcgataac ggaccgtccg       180
     gaacgacgcg aactggaccg gctgcttgca atcggtgaag aacagacgat ttcattactc       240
     agcatcgccc tgaactcact cgggataaaa gccttgtcgc agacaggggc ccaggcaggc       300
     atcagcacga tgggactgca cacgaaaagt aaaatcaaac agattgacgg cgaattgctc       360
     cggaaaaaac tggagacata cgacgtcatc atcgtcgccg gtttccaggg cgtcaatgag       420
     ctcggggatg tcacgacact cggtcgcggc ggatcggata cgacagccgt cgcattggcc       480
     gcggttcttg ataaacgatg tgaaatttac acggacgtcg acggtgttta cacagctgat       540
     ccacggattc atgcaacggc acaaccgatt ccacacattt catacgatga gatgatggaa       600
     atgagtgcac tcggttcaaa agtcatggag atgcgcagtg tcgaactcgg taaaaaatac       660
     ggcgtccaca tcttcgtcgg aaaaacatta gaatcggaaa gagggacttg gatcatggag       720
     gcaacggaaa cgatggaaca aaaagcggtc acgagcgtca gtgtaacgaa aaacgtgttg       780
     acggtgtcaa tcaagcatgt accgcagacg aactcggcgg tcgcggatat ctttgaactg       840
     ttatcaggac gtcacgtcaa catcgatatg atcagtcaga cgacgtttga cagtgacatc       900
     ttcctttcct tctcttgtcc gctggatgaa gaagagtttt tggaagaagc actgcaggat       960
     atcatcaatc gtttcccgac ggtcaaagtc gaccgtcata accagcatgc caagttatcc      1020
     gtcgtcggaa tcgggatgcg ggacgcaacc ggggtcgctt cgaaattgtt tgcgacgttc      1080
     cgggcggaaa acatcacgtt ttatcaagtc acgacatcag aaatcagcat ctcatatacg      1140
     attgcccagg ccgatatcga acggactgtc gcagcaatcg caaaagcatt cgatctgtaa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page