(data stored in ACNUC7421 zone)

EMBL: CP001022.PE485

CP001022.PE485       Location/Qualifiers
FT   CDS_pept        524597..525655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0491"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: sha:SH1512 alanine racemase 2; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59973"
FT                   /db_xref="GOA:B1YJ43"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ43"
FT                   /protein_id="ACB59973.1"
FT                   /translation="MSSRTVVTIDREAVRHNVASVFARSNKQIFAVVKNNAYNLGMIEM
FT                   VATLMEAGVRHFAVAEVYEAIEIKTNFPDSYVLAMNPASDFKEVRLHGVALGIPSLDWL
FT                   TRHQADLSGIELHLKINVGMNRFGVSSLEEALAVLETVREQELTLTGLYTHFPLADEPG
FT                   ADHDGQVERFLEIGNPLQAKHSFTYIHAENSATIVKHDPRLACCNYVRPGIFLFGYSPI
FT                   EKMDWLVPSLRMTTEVVEIRQVEAGEHVGYGTSYTAPTAIRVAVLPVGYGDGVVRGRSS
FT                   LPVIINGKRYPIISKLFMSHTFIAVDSTVEIGDKVVLYGDGIEIDDITRTGTANNSEQM
FT                   CARSWRLTHRYL"
     atgagttcaa gaactgtcgt taccattgat cgggaagcgg tgcggcataa tgtcgcatcg        60
     gttttcgccc ggtctaacaa gcagattttt gccgtggtca aaaacaatgc ttacaactta       120
     gggatgattg aaatggtcgc cacattgatg gaagccggtg tccggcattt cgcagtggcg       180
     gaagtctatg aagcaattga aatcaaaacg aattttccag acagttatgt cctggcgatg       240
     aatccggcat cggattttaa agaggtccgc ttgcatggag tagcgctcgg aattccttcg       300
     ctcgattggc tgacacgtca tcaggcggat ttatcgggaa ttgaactgca tctaaaaata       360
     aatgtcggga tgaaccgttt tggtgtcagt tcgctcgaag aagcattagc ggtgcttgaa       420
     accgtacggg agcaagagct gacgttaaca gggctctaca cgcatttccc gcttgccgat       480
     gaaccgggag ccgatcacga cggtcaggtt gaacggttcc ttgaaatcgg aaatccgtta       540
     caggcgaaac atagctttac ttatatccat gccgaaaaca gtgcaacgat cgtcaagcat       600
     gatccgcgcc tcgcctgttg caattacgtc cggcccggta tattcctgtt tggctattcg       660
     ccgatcgaaa aaatggattg gctcgtcccc tcactccgga tgacgacgga agtcgttgag       720
     attcgtcaag tggaagcagg ggaacatgtc ggctacggta cgtcgtatac ggcaccgaca       780
     gcgattcgtg tcgccgttct gccggtcggc tacggggacg gggttgtccg cggacggtcg       840
     tcactgccgg tcatcatcaa cggaaaacgt tatccgatca tcagtaagtt atttatgagt       900
     catacgttca tcgccgtcga ttcgacggtg gaaatcggtg ataaagttgt tctgtacgga       960
     gacggcatcg aaattgatga catcacccgg accgggacag ccaataattc ggaacagatg      1020
     tgtgcccgtt cgtggcgttt aacacatcgt tatttataa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page