(data stored in ACNUC7421 zone)

EMBL: CP001022.PE493

CP001022.PE493       Location/Qualifiers
FT   CDS_pept        534003..534260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59981"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ51"
FT                   /protein_id="ACB59981.1"
FT                   /translation="MDKSYFEGHEKLIADVYRSFIDQFHELPNNRRTKRQLRNLAFSVI
FT                   RQAGPTYQERTVLYAFFAEFFRAVEEGQREEIEFYKQIAQ"
     atggataagt catattttga aggtcatgaa aagttgattg ctgatgtata ccgttcgttt        60
     atcgaccagt ttcatgagtt accaaacaac cggcgtacaa aacgtcagtt acgaaatctt       120
     gcgttttcag tgattcgaca ggctggtccg acctatcagg aacgaaccgt cttatacgca       180
     ttttttgctg aatttttccg tgctgtcgaa gaaggacagc gggaagaaat cgaattttat       240
     aaacaaatcg cacagtaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page