(data stored in ACNUC7421 zone)

EMBL: CP001022.PE496

CP001022.PE496       Location/Qualifiers
FT   CDS_pept        536893..538287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0502"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: Spore germination protein; amino acid
FT                   permease-associated region; KEGG: cpr:CPR_0159
FT                   arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59984"
FT                   /db_xref="GOA:B1YJ54"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ54"
FT                   /protein_id="ACB59984.1"
FT                   /translation="MNQQKIGFFALAAMVIGSMVGGGAFNLPGAMAQKASAGPILIGWG
FT                   ITGLGMIMLALVFQHLANSKPELEGGIYAYAREGFGRFVGFNSAWGYWVSAWIGTVANI
FT                   TLVFNALSYFFPIFSSENRVFLLVMSIVVVWGLFFIVSSGIKEATLVNLITTIAKLVPI
FT                   LIFILLVAIAFNVKTFNLNFWGEGTELGSIFTQVKGTMLVTLWAFVGIEGAVVLSTRAN
FT                   KRSDVGKATVVGLVGVLVIYILISVLSLGVLNQEQLAGLQEPTMAYVLEAAIGPFGATL
FT                   IMVGLIISLSGALLGWTILASEISYLVAKDGAFPKFFAKTNRKGAPVGALLITQIATQF
FT                   VAGIALFSAQTYLVLSSIAGICALLPYLLSAVYSVRFSRAERNTKMLIFSTIAAAYSLW
FT                   LVYASGIWYIVIAALVYAPGIIAYLMAEREQKRGGMSRYEMIASGILIILAAVAVYGMI
FT                   GGQIQL"
     atgaatcaac aaaaaatcgg cttttttgct ttagccgcaa tggtcattgg atcgatggtc        60
     ggtggaggtg ccttcaatct gccgggagca atggctcaaa aagcgagtgc aggtccgatt       120
     ctaatcggat ggggaattac tggtcttggc atgattatgc tggcgctggt ctttcaacac       180
     ttggcaaaca gtaaaccgga acttgaaggc ggcatttacg catatgcccg tgaaggattc       240
     ggacgatttg tcggttttaa cagcgcctgg ggatattggg tctcggcctg gatcgggaca       300
     gttgccaaca taacgttggt ctttaatgca ctcagttact ttttcccgat tttctcatca       360
     gaaaatcgtg tatttttgtt agtgatgagt atcgttgtcg tatggggact gtttttcatc       420
     gtctcgagcg ggattaaaga agcgacactt gtcaacctga ttacgacgat cgcaaagctc       480
     gttcccattt tgatttttat tttattggta gcaattgctt ttaatgtgaa gacgtttaac       540
     ctgaattttt ggggagaagg aacggaatta ggcagtatct ttacgcaagt caaaggaacg       600
     atgcttgtga cgctttgggc cttcgtcggg attgaagggg ctgtcgtctt gtcgacacgc       660
     gccaacaaac ggagtgatgt cgggaaggcg acagtcgtag ggcttgtcgg agtacttgtc       720
     atctacatcc tgatttccgt cttatcgctc ggtgttttga accaggaaca gttagcagga       780
     ttacaagaac caacaatggc ttatgtgctc gaagctgcga ttggtccgtt tggagcaacg       840
     ttgattatgg tcggactgat catttcgtta tccggagcac tgctcggatg gacgattctg       900
     gcgtctgaaa tttcttatct cgtggctaaa gacggtgctt ttccaaagtt ctttgccaaa       960
     acgaaccgga aaggggcgcc ggtcggtgcg ttgctgatca ctcaaattgc gacccagttc      1020
     gttgcaggta tcgccttatt ttctgcacag acgtatttag tcttatccag tattgccgga      1080
     atttgtgcat tgttgccgta tctgttgtct gccgtgtaca gtgtccgttt ttcacgggca      1140
     gaacgcaata caaagatgct gatcttctcg acgattgccg ccgcctattc actgtggctc      1200
     gtctacgctt cagggatttg gtatatcgtc atcgcagccc tcgtctatgc accgggtatc      1260
     atcgcctatc tgatggcgga gcgggagcag aagcggggcg gtatgtcgcg ttacgaaatg      1320
     attgcgagtg gaattttaat tatcttagct gcggttgcag tttacgggat gatcggtgga      1380
     caaattcaat tgtaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page