(data stored in ACNUC7421 zone)

EMBL: CP001022.PE500

CP001022.PE500       Location/Qualifiers
FT   CDS_pept        542309..543817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0506"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, N-acetylglucosamine-specific
FT                   IIBC subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS EIIB protein;
FT                   phosphotransferase system EIIC; KEGG: bce:BC0482 PTS
FT                   system, N-acetylglucosamine-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59988"
FT                   /db_xref="GOA:B1YJ58"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ58"
FT                   /protein_id="ACB59988.1"
FT                   /translation="MLQFLQRIGKALMLPIAVLPAAGIVLRLGSADMLDIPLMVAAGGA
FT                   IFDNLPLIFAIGVAIGLSIDASGAAGLAGAVGYLVLKTGVDSMNKDYSNAQIQAKYDAI
FT                   AAIVNDSSTKVDGATLSSIANQATLGSMVNMAVFGGIIAGIVAGLLYNRFYNIKLPDWL
FT                   AFFGGRRFVPIITSAAMLVLAFVFGYLWPFIEDGINNAGEWMVSLGAGGAALFGFFNRL
FT                   LIPVGLHHVLNNIFWFVFGSYEKADGTIANGDIARFFAGDPTAGIYQAGFFPIMMFALP
FT                   AAAAAMVMAARKENRKAVAGAMIGLGLTSFLTGITEPIEFSFMFLSPVLYVMHAVLTGV
FT                   SMAVVNLLGILHGFSFSAGFIDYVLNFGIATKPLLLLVVGLVFAVIYYFLFYFMITKFD
FT                   LKTPGREDESLVTDAGPVTGVSDDKYEQQAARIFAGLQGTDNVTAIDNCATRLRLQVKD
FT                   STIIDEAAIKAAGAKGVMKMGAKNVQIIIGTDVEFVADAMKRQK"
     atgttgcagt ttcttcaacg aatcggtaaa gctttaatgc tgccgatcgc cgttttacca        60
     gccgcgggaa ttgtccttcg actcggttca gccgatatgt tggatattcc gttaatggtg       120
     gcagcaggtg gtgcgatttt tgataatctt ccactaattt ttgcgattgg tgtcgcgatc       180
     ggattatcga ttgatgcaag tggcgctgcc ggcttggcag gagcagtcgg gtatctggtc       240
     ttaaaaacgg gtgtcgactc catgaacaag gattattcga acgctcaaat tcaggctaag       300
     tacgatgcaa tcgccgccat tgtcaatgac tcctcgacga aagtggatgg ggcgacctta       360
     agttccattg ccaatcaggc aactttaggt tcgatggtca atatggctgt gttcggcggg       420
     atcattgccg gtattgtcgc cggtttgttg tacaaccgat tttacaatat taaattaccg       480
     gattggttag cattcttcgg cggacgccgt tttgttccga tcatcacgtc agccgctatg       540
     ctggtcttag cgtttgtctt tggttactta tggccgttca ttgaagacgg aatcaataat       600
     gcgggagaat ggatggtcag ccttggagca ggaggggccg cactgtttgg attcttcaac       660
     cgtctgttaa ttcctgtcgg tcttcaccat gtcttgaaca atattttctg gtttgtcttc       720
     ggttcatatg aaaaagcgga tggaacaatt gcgaatggag atatcgcacg cttcttcgct       780
     ggagatccga cagccggtat ttatcaagcc ggatttttcc cgatcatgat gttcgcttta       840
     ccggctgcag cagcagccat ggtcatggcg gcacgcaaag aaaatcggaa agccgtcgca       900
     ggggcgatga ttggtcttgg attaacatca ttcctgacag ggattacgga accgattgag       960
     ttttcattca tgttcttgtc accggtctta tatgtcatgc acgccgtgtt gacgggtgtt      1020
     tccatggcag tcgtcaattt actcggtatc ttgcacgggt tctccttctc tgccggtttc      1080
     attgactatg tcctgaactt cggaatcgcg acaaaaccgt tgcttttact cgttgtcggt      1140
     ctcgtattcg ccgtcattta ttacttcctg ttctacttca tgatcacgaa atttgatctg      1200
     aaaacgccgg gtcgtgaaga tgaatcactt gtaacggatg caggccctgt cacgggtgta      1260
     tcagacgata agtacgagca acaagcagcg cggatttttg caggcttaca aggaacggac      1320
     aacgtcacag cgattgataa ctgtgcgaca cgtctccgtc tccaggtaaa agattcaacg      1380
     atcattgacg aagcggcaat taaagcggcc ggcgcaaaag gtgtgatgaa gatgggcgcg      1440
     aaaaacgtcc aaatcatcat cggtacggat gttgagttcg tcgctgatgc gatgaaacgt      1500
     caaaaataa                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page