(data stored in ACNUC7421 zone)

EMBL: CP001022.PE504

CP001022.PE504       Location/Qualifiers
FT   CDS_pept        546619..547557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0510"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bha:BH3950
FT                   transposase (10)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59992"
FT                   /db_xref="GOA:B1YJ62"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ62"
FT                   /protein_id="ACB59992.1"
FT                   /translation="MSYIHLTISERVKIETYLELGFSVRKIAGRLGRQPSTISRELKRN
FT                   PHYDSSHAGQRYVERKKKCGARTKFTLEKGICILEKLRETWSPEQIAGRLFQEEGLSFK
FT                   TIYRWIYSGLVEADSGLLRQKGKRQKPRETRGRFNVGLPISKRPSDVKGRQTFGHWELD
FT                   TVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTD
FT                   RGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIA
FT                   QALAWINGRPRKCLNWKTAYEVFTEEVLHLI"
     atgagctata ttcatcttac catatcagaa agagtcaaaa tagagacgta tctcgagcta        60
     ggtttctctg tccgaaagat tgcgggacgc ctggggcgtc aaccttctac gatttcacga       120
     gaattgaaac gaaatcctca ttacgattct tctcatgctg gccagcgtta tgtggagcga       180
     aaaaagaagt gcggtgcacg tacgaagttt acgctcgaaa aaggaatctg catcctcgaa       240
     aaattacggg agacgtggtc ccctgaacaa attgccggac gattattcca agaagaagga       300
     ctctcgttca agacaattta tcgttggatt tatagtggcc tcgtcgaggc cgattctgga       360
     cttcttcggc aaaagggaaa gcgtcagaaa ccacgtgaga cgcgcggacg cttcaacgtc       420
     ggactgccaa tcagtaaacg tccgtccgac gtcaaagggc gtcaaacgtt tggacattgg       480
     gagcttgata ctgttgtatc gggtagagga acgtcaaaag cctgtgtcgc aacgttcgtc       540
     gagcgaaaga gtcgttttta tctcgctgta ccgatggaaa atcggtccgc tcaatcgatg       600
     gagtctgcga ttcaagcatt acatctttcc ttcccgttgg gaacgttcca aactgcgacg       660
     acagatcgtg gaaaagagtt tagctgtcat gaacgaattc gtgacacgtt aggcttaccc       720
     atgtattttg cagatccgta ttcttcttgg cagcgtggta gtaacgagaa cgccaatggt       780
     cttctccgtg aatttttccc gaaggggaca gatttcggaa aggtcagtcg ttctgaaatc       840
     gctcaagcgc tcgcctggat taatgggaga ccacgaaaat gtcttaactg gaaaactgca       900
     tacgaggtct tcacggaaga agtgttgcac ttaatttga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page