(data stored in ACNUC7421 zone)

EMBL: CP001022.PE505

CP001022.PE505       Location/Qualifiers
FT   CDS_pept        complement(547623..547769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_1004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59993"
FT                   /db_xref="InterPro:IPR025432"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG3"
FT                   /protein_id="ACB59993.1"
FT                   /translation="MEQPFYQETSPEFYRQLPVKTCSHCGKEMDEQCESYKTECDECAV
FT                   TEH"
     atggaacaac ccttttacca agaaacttct ccggagtttt accgtcaact tccggtcaag        60
     acctgctctc attgcggaaa agaaatggat gaacagtgcg aatcatataa aacagaatgt       120
     gatgagtgcg ctgttacaga acactga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page