(data stored in ACNUC7421 zone)

EMBL: CP001022.PE508

CP001022.PE508       Location/Qualifiers
FT   CDS_pept        549570..550931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0514"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: gtn:GTNG_1608 two component
FT                   system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59996"
FT                   /db_xref="GOA:B1YJG6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG6"
FT                   /protein_id="ACB59996.1"
FT                   /translation="MRHISYYIGLLFLTAILVIGGILFSTLYFNLVNQRTDEVVLGLLN
FT                   RGNTHRDVLEESFNAETLEHVSLMESASEFTVVITDQKGKILKASHPLTPKMKVELIHT
FT                   EFQTQRKDRILRAQAETKGFFMTDSPITISGVHRGHVFMFAPETLIQQVVDPLRQQFIQ
FT                   VGIIAVLLSLTTVVLCTRLISRPLIEMERATAKLKEGNLDVDLPVNRSDELGALARSIT
FT                   QLAKDLDFLNRERTEFLANISHELRTPLTYMKGYADILHRPNLPESEKTAYLSIIKEES
FT                   DHLSTLIEQMMLLARSDTNAFSVERVPLALDQLIVSTTEKMRPAIEEKGLHLHVSGEPV
FT                   EIAGDEIRLKQVLINVLDNAKKYTATGEIVVRYGRNETGPYFQVRDTGSGISQESLPHV
FT                   TKRLYRSEPSRSRSRGGSGLGLTIALAIVQAHDATLDIKSEKNAGTSVMIQWKV"
     atgcgacata tttcttacta catcggtctg ctttttttga ctgcgattct tgtcatcggc        60
     ggtattctgt tcagtaccct ctactttaat cttgtgaatc aacggacgga cgaagtggtc       120
     cttggtttgt tgaaccgggg aaatacacac cgtgatgtcc tcgaggaatc ttttaatgca       180
     gaaacattgg aacatgtcag tttgatggaa tcagcatccg aatttaccgt cgttatcacg       240
     gatcaaaaag gaaaaatttt aaaggcttcg catccactta ctcccaaaat gaaagtagag       300
     cttatccata cggaatttca aacacaacga aaagatcgga ttttaagagc tcaagcggaa       360
     acgaagggtt tttttatgac agatagtcca atcacgattt caggtgttca tcgtgggcat       420
     gtcttcatgt ttgctccgga aacgttaatt caacaagtcg tcgacccgtt aagacaacaa       480
     ttcattcaag ttggtatcat tgccgtcctt ctgtcgctta cgactgtcgt gctgtgtaca       540
     cgattgattt caagaccact cattgagatg gagcgtgcga cggccaagtt gaaagaagga       600
     aaccttgacg tggatttacc ggtaaaccgc tcggatgagc ttggggcact ggcacgctcc       660
     atcacacagt tggcaaaaga tcttgatttt ttgaatcgtg aacggacaga atttttagca       720
     aatatctcgc acgaacttcg aactccgctg acctacatga agggttatgc ggatatatta       780
     catcgtccaa acttgccgga atctgaaaaa acagcttatc tgtcgattat caaagaagaa       840
     agcgatcatt tgagcacatt gattgaacag atgatgttac tggcacgttc cgatacgaat       900
     gcattctcag tcgaacgagt gccgcttgcg ctcgatcaat tgattgtctc gacgacagag       960
     aaaatgcgac ctgcaattga agaaaaaggg ctgcatttgc atgtatcagg ggaaccggta      1020
     gagatagcag gagatgaaat tcggctcaag caagtgctga taaatgtatt ggataacgca      1080
     aaaaaatata cagcaaccgg tgaaatcgtc gtccgatacg gcaggaatga aacaggaccg      1140
     tattttcaag tacgtgatac aggaagcggc atcagccaag aaagtttacc ccatgtgaca      1200
     aaacgtctgt accgcagtga accgtcacga tcacgaagcc ggggcggatc agggcttggt      1260
     ttgacgattg ccttggcaat cgttcaagca cacgatgcga cattagatat caagagtgaa      1320
     aagaatgccg ggacgagtgt gatgattcaa tggaaggtgt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page