(data stored in ACNUC7421 zone)

EMBL: CP001022.PE509

CP001022.PE509       Location/Qualifiers
FT   CDS_pept        550936..551616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0515"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcy:Bcer98_0503 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59997"
FT                   /db_xref="GOA:B1YJG7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG7"
FT                   /protein_id="ACB59997.1"
FT                   /translation="MARILIVDDEQRMLQLMKLYLTPYGHTCHLVDSAEKAIEIVKTVP
FT                   IDIALLDVMMPEMDGWTLCENIRRIADFPIIMVTARNQMEDVVRGRTVGADDYVAKPIH
FT                   EGELLGRIELLIGREKREQYTFHGLHYDAKGYDCSFDEQKILLTKTEFQLLGKLLASVN
FT                   RILSREQLVRSLWSDDQSIEPRTIDSHMRHLREKLRRSGFPIDEYLETVRGVGYRLLEQ
FT                   TKDS"
     atggctcgaa ttttaatcgt tgatgatgaa caacggatgc ttcaattaat gaaattatat        60
     ttgacaccgt atggtcatac gtgccatttg gtcgattccg ctgaaaaagc aatcgaaatc       120
     gtcaaaacag ttccgattga tatcgcttta ctggatgtca tgatgcctga aatggatggt       180
     tggacactat gtgaaaatat aagacgaatc gctgatttcc cgatcatcat ggtaacggca       240
     cggaatcaaa tggaagatgt cgttcgggga cgtacagtcg gcgccgatga ttatgtggcg       300
     aaaccgattc atgaaggtga actattagga cggattgagt tattgattgg acgagaaaag       360
     cgggaacagt atacatttca tggtctgcat tatgatgcta agggatatga ttgtagtttt       420
     gatgaacaaa aaatcttact gaccaaaaca gagtttcagc tgttaggaaa actcctggct       480
     tccgtaaata gaatcttatc gagagagcaa ttagtgcggt cgctttggag tgacgaccaa       540
     tcgattgaac cacgaaccat cgattctcat atgcgccacc ttcgtgaaaa actgcggcgt       600
     tccggctttc caatcgatga gtatttggag actgtccgag gtgtgggtta tcgtttactg       660
     gagcagacaa aagacagcta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page