(data stored in ACNUC7421 zone)

EMBL: CP001022.PE512

CP001022.PE512       Location/Qualifiers
FT   CDS_pept        complement(553745..554290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0518"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: xcv:XCV0113 putative protein-S isoprenylcysteine
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60000"
FT                   /db_xref="GOA:B1YJH0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH0"
FT                   /protein_id="ACB60000.1"
FT                   /translation="MTILDKVFIAVSLLWLFELFLFRNRKKEPSPLEERQSFYWILATL
FT                   ITTILFSVLFSDSIRLPLSREIGLLLLTSGVVLRYWGIYHLKHQFTRHVAVNPGDRLVS
FT                   TGPYRALRHPLYSGLFFITLGFPLYFGNLFVTLCAGILMFIALLHRIRIEEQMLTKGFG
FT                   PAYTDWARKRKRLIPFIY"
     atgaccattt tagataaagt gttcattgcc gtctctcttc tttggttatt cgaattgttt        60
     ctgttccgaa accgtaagaa ggaaccttct ccactggaag aacggcaaag tttttattgg       120
     attttagcta cgttaatcac cacaatcctt ttttccgttc tgttcagtga ttcaattcga       180
     cttcccttgt cacgtgaaat cggattgctc cttttgactt ccggtgtcgt tctgcgctat       240
     tgggggattt atcatctcaa gcatcagttc acccgccatg ttgctgtcaa tccgggcgac       300
     cggcttgtca gcacgggtcc ttatcgggca ttacgccacc ccctctattc cggtctgttt       360
     tttatcacgt taggtttccc gttatacttc gggaatttgt ttgtcacgtt atgtgccgga       420
     atcctgatgt tcatcgcttt gcttcaccgt attcgaatcg aggaacagat gttaaccaaa       480
     ggatttggtc ctgcttacac ggactgggcc cgcaaaagaa aacgtttgat tccgtttatt       540
     tactaa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page