(data stored in ACNUC7421 zone)

EMBL: CP001022.PE519

CP001022.PE519       Location/Qualifiers
FT   CDS_pept        complement(562454..564895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0526"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="TIGRFAM: YhgE/Pip N-terminal domain protein;
FT                   YhgE/Pip C-terminal domain protein; PFAM: ABC-2 type
FT                   transporter; KEGG: lwe:lwe2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60007"
FT                   /db_xref="GOA:B1YJH7"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH7"
FT                   /protein_id="ACB60007.1"
FT                   /translation="MFRSEWKKLKSPMMIIVILALILVPFLYNSIFLSAFWDPYGKTEN
FT                   IKVAVVNEDKATKFEGEKIDIGNQFVKKLKKNDDFDWQYLSRKDAAKKLRAGDIYMTVV
FT                   IPKKFSHNATTLLDDHPKKIELEYYLNPAKNYSGTQISSAAAKQLNEKIRKSVTKQYSS
FT                   AIFGSLKKIAKGLEDASEGSAKLEDGAKKTTDGAKTLTTNLSKLTSGTNELSTNLTKAA
FT                   DGSVQLTSGLNTLSGGTKTLAEKSGELSSGLNQLDDNSGKLMKGSADLQAGSTKLRQGL
FT                   ESSAAGSTKLRQGLESSAAGSTELRQGLETASAGASKLDNNLPEFTAGLDQLNARAQEA
FT                   NASLVAVNDAADTLKQELSTRREALEENIASIKAVIASSETLTEEEKGALLQSIATMEQ
FT                   NVQNLAQQESILDASLAKANDATEKINQLAVGGQSIASAVSQLDGGLAQLLDGSKRLEQ
FT                   GQTQLLAGSKQLEQGQTQLLAGAKSLEQGQGTLTQGLTAYTDGVHKAAVGSTQLTAGAQ
FT                   QLATGANDASTASGQLTSGLGQLSDGAVAISSGAGQLTDGASRLADGNSKLADGANTLK
FT                   TELGKGAKDATVKPSNARDNMLAEPVVLKEHDYSTVNNYGSGLAAYILSIALFAGALMF
FT                   SSVYQIRPEHGETLTWRFLVGKLSIILPIGALQGIAASVAIIYVLDADVASTPALYGFA
FT                   ALTGMTFITLLFMLTMLFGRVGQFSAFLLLLLQIGGSGGTFPVEMTPSFFQTIHRFLPM
FT                   TYSVTGFREALGIGVTDTLITNGQILGLILFSALAISFAGALGGKRILLSTKARKRHDT
FT                   V"
     atgtttcgtt cagaatggaa aaaattaaaa agcccgatga tgatcatcgt gattcttgca        60
     cttatcctcg tcccgtttct ttataactcg atctttttat ctgctttttg ggatccgtat       120
     ggtaagacag aaaacattaa ggtcgcagtc gtcaatgaag acaaggcgac gaagttcgag       180
     ggagaaaaaa ttgatatcgg aaatcagttc gtcaaaaaac tgaaaaaaaa tgatgacttt       240
     gactggcagt atctctcacg taaagatgcg gctaaaaagc ttcgcgccgg tgatatttac       300
     atgacagtcg tcatcccaaa gaagttttct cataatgcga ctactttact cgacgatcat       360
     ccgaaaaaaa ttgagttgga atattatctg aatccagcca aaaactattc cggtacgcag       420
     atttccagcg ctgccgctaa gcaattgaac gaaaaaatcc ggaaatccgt cacgaaacaa       480
     tacagcagtg cgattttcgg atcccttaaa aaaattgcca aaggactaga agatgcatcc       540
     gaaggttcag ccaaactgga agatggcgcg aagaaaacga cagatggcgc aaaaacactg       600
     acgacgaatc tcagtaaact aacgagtggg acaaatgagt tgtccacgaa tttaacaaaa       660
     gccgcggacg gttccgtcca gcttacaagc ggtctcaaca cgttaagcgg tggaacaaaa       720
     acactggcag agaagtccgg tgaattatcg agcggcctca atcaactcga tgacaacagc       780
     ggaaagttaa tgaaaggttc agccgatcta caggccggat cgacaaaact ccgccaaggt       840
     ctcgaaagtt cagctgccgg atccacaaaa cttcgtcaag gtctcgaaag ttcagctgcc       900
     ggatcgacgg aactccgtca aggtctcgaa acagcttcgg ccggtgcgtc gaagctcgac       960
     aacaacctgc cggagttcac agccggtctc gatcaactga acgcccgggc tcaagaagcc      1020
     aatgcctcgc tggtagcagt caacgatgcg gcggatacgt taaaacaaga gttaagtact      1080
     cgtcgtgaag cacttgaaga aaatatcgcg agtatcaagg cagtcattgc ttcatctgaa      1140
     actttaacgg aagaagaaaa aggtgctttg cttcaatcca tcgcaacgat ggaacaaaac      1200
     gttcaaaatt tagcacagca agaatcgata cttgatgcaa gcctcgctaa agcgaatgat      1260
     gcaacagaaa aaattaatca gcttgcggtt ggtggtcaaa gtattgcttc tgccgtctcg      1320
     caactcgatg gtgggctcgc acaactgctt gacggttcaa aacgattgga acaaggacaa      1380
     acccaactac ttgctggttc aaaacaatta gagcaaggac aaactcaact acttgccggt      1440
     gcaaaaagtc tcgaacaagg acaaggcacg ctcacgcaag gtttgacggc ctatacagac      1500
     ggcgtgcata aagcagctgt cggaagcacc caattaacgg ctggtgccca gcaactggca      1560
     accggtgcga acgatgccag tacagcatcc ggtcaattga cttctggtct cggtcagctg      1620
     tcagacggtg ccgtcgccat ttcttccggt gccggtcaac tgacggatgg cgcttcacgc      1680
     ttggcagatg gaaactcgaa acttgccgat ggtgccaaca cattgaaaac cgaactcggt      1740
     aaaggcgcga aagatgcgac tgtcaaacca tccaacgccc gggacaacat gctcgctgaa      1800
     ccggttgtct taaaagaaca tgattattcg accgtcaaca actacggatc aggtcttgcg      1860
     gcttacatcc tcagcatcgc cttgtttgcc ggtgccttga tgttctcttc tgtttaccag      1920
     atccgtcctg aacatggtga aacattaacg tggcggttcc tcgtcggaaa actgtcgatc      1980
     atcttaccga ttggtgcgtt acaagggatt gcggcttccg tcgccattat ttatgtactt      2040
     gatgcggatg ttgcaagcac ccctgcactg tatggtttcg ctgctttgac agggatgacg      2100
     ttcatcacac tactctttat gttaaccatg ctctttggtc gggtcggaca attcagcgcc      2160
     ttcctactgt tgttactgca aattggcggc agcggcggaa cattcccggt cgaaatgact      2220
     ccaagcttct tccaaacgat tcaccgcttc ctgccgatga cttactcggt cacaggtttc      2280
     cgtgaggcac ttggaatcgg agttaccgat acactcatca caaacggtca gattcttggt      2340
     ttgattctgt tttctgctct cgctatcagc ttcgctggtg cattaggtgg aaaacgcatc      2400
     ttactctcaa cgaaagcgag aaaacgccat gacactgtct ga                         2442
//

If you have problems or comments...

PBIL Back to PBIL home page