(data stored in ACNUC7421 zone)

EMBL: CP001022.PE52

CP001022.PE52        Location/Qualifiers
FT   CDS_pept        71776..72537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0053"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: bce:BC0073 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59540"
FT                   /db_xref="GOA:B1YGQ7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGQ7"
FT                   /protein_id="ACB59540.1"
FT                   /translation="MILVIDVGNTNIVLGVYDEQTLLQHWRIATDRTRTTDEYGMLVKA
FT                   LFRDAELNVEDIEGIVLSSVVPPVVFPLENMCVRYFNRRPFVIGPGIKTGLDLKVDNPR
FT                   EVGADRIVNAVAATVKYDGPLIIVDFGTATTYCYIDAQKRYYGGIISPGVMVSTEALYN
FT                   KAAKLPRIEIAKPQSTIGRNTVHAMQSGTYFGYVAQVDGLVHRMKEEMGEATVIATGGL
FT                   ARLISEESATIKIVDPFLTLDGLRIIYERNK"
     atgattttag taatcgatgt aggaaatacg aatatcgtcc ttggggtata tgatgaacaa        60
     acccttctgc aacattggcg gattgctacg gaccggaccc ggacaaccga tgaatatggc       120
     atgctggtga aagcactgtt tcgtgatgca gagttaaacg tggaagacat tgagggaatc       180
     gtgttatcat ctgtcgtacc ccctgtcgtg tttccgctcg aaaacatgtg cgtccgttat       240
     ttcaaccggc gtccattcgt aatcggaccc ggaatcaaga caggacttga cttgaaagtc       300
     gataatccaa gagaagttgg agccgaccgg atcgttaatg ccgtcgcagc gacggtcaaa       360
     tacgatggtc ctttgatcat cgtcgatttt ggaacagcaa cgacctattg ttatatcgat       420
     gcacaaaaac gctattacgg tggaatcatt tcaccgggtg tcatggtgtc gacagaagca       480
     ctttataata aggcggcgaa attaccgcgg attgagattg ccaaaccgca gtcgacgatc       540
     ggccgcaata cggtacatgc gatgcagtct ggaacgtatt tcggatacgt cgcgcaagtc       600
     gatggactcg tccatcggat gaaagaggaa atgggagaag cgactgtcat tgcgacaggt       660
     ggacttgccc gactaatcag tgaggaatct gcaacgatta aaatcgtcga tccatttttg       720
     acgcttgacg ggttgcggat tatctacgaa cgaaataagt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page