(data stored in ACNUC7421 zone)

EMBL: CP001022.PE521

CP001022.PE521       Location/Qualifiers
FT   CDS_pept        566159..566425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0528"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   btk:BT9727_4526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60009"
FT                   /db_xref="GOA:B1YJH9"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJH9"
FT                   /protein_id="ACB60009.1"
FT                   /translation="MKQVLLGGIHFYQKVISPMKPATCRFYPTCSHYGKEAIEKHGALR
FT                   GGYLTTRRLLRCQPFHPGGLDFVPETFDWKAPLQRENPAEHQK"
     ttgaaacaag tcctactcgg tgggattcat ttttatcaaa aagtgatttc gccgatgaaa        60
     ccggcgacct gccgatttta tccgacctgc tcgcattacg gaaaagaagc aatcgagaag       120
     catggtgcct taagaggcgg ttatttaacg acccgtcgtt tgttacgttg ccaaccgttt       180
     catccgggcg gactcgactt tgtaccggag acatttgact ggaaggcgcc gttacaacgg       240
     gaaaacccgg cagaacatca aaagtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page