(data stored in ACNUC7421 zone)

EMBL: CP001022.PE525

CP001022.PE525       Location/Qualifiers
FT   CDS_pept        569878..570360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0532"
FT                   /product="protein of unknown function DUF456"
FT                   /note="PFAM: protein of unknown function DUF456; KEGG:
FT                   bpu:BPUM_2231 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60013"
FT                   /db_xref="GOA:B1YJI3"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI3"
FT                   /protein_id="ACB60013.1"
FT                   /translation="MTIILWSLIAVCFLVAFAGLVYPVIPSAPLLIIGFLIYGFGFGFT
FT                   ELTVSFWVIQAIFVILLFTLDYLVSSYTVDRRGGSQAAKIATTVGLIAGPFILPGIGLL
FT                   IFPFVFAILTEKIISKKTWKDSVSIGIGTVLGILSSALLKGIAMLLMIVVFILYVV"
     atgactatca tattatggag tttgattgca gtctgttttt tggttgcgtt cgcaggactt        60
     gtctatcctg tcattccaag tgcaccgtta ctcatcattg gatttttgat ttatggattt       120
     ggattcggtt ttaccgagtt gaccgtcagt ttctgggtca ttcaagctat cttcgttatc       180
     ctgttattta cgttagatta tttggttagc tcttataccg ttgatcgacg cggcggttca       240
     caggccgcaa aaatcgcgac gaccgtcggt ttgattgccg gtccctttat cctgcctggg       300
     attggattgt tgattttccc gttcgtcttt gcgattttaa cggaaaaaat catcagtaag       360
     aaaacatgga aggattctgt ttcaatcgga atcgggactg tgttgggcat tctgtcgagt       420
     gccttattaa aagggatcgc catgctgtta atgattgtcg tattcatcct gtatgtcgtg       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page