(data stored in ACNUC7421 zone)

EMBL: CP001022.PE527

CP001022.PE527       Location/Qualifiers
FT   CDS_pept        572037..572477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0534"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcl:ABC1785 organic
FT                   hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60015"
FT                   /db_xref="GOA:B1YJI5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI5"
FT                   /protein_id="ACB60015.1"
FT                   /translation="MTKTILTSRATAVGGRDGKVASDDNVINLDLVMPGTKGKEDIPTS
FT                   NPEQLFAAGYAACFDGAFNLMARQDKKRVETRTNSEVSLLEDEEAGGVKIAAKLVVEVV
FT                   GVTEEEAQDLLEKTHQFCPYSKATRGNIDVDLSVKVVDSLDN"
     atgacgaaaa caattcttac ttcacgtgca actgcagtag ggggacgcga tggaaaggtc        60
     gcctctgacg ataacgtaat taatttagat cttgtcatgc caggtacgaa aggcaaagaa       120
     gatattccta cttcaaatcc agaacaatta ttcgcagcag gatacgctgc atgctttgac       180
     ggggcattca acctgatggc tcgccaagat aaaaaacgtg ttgagacacg tacgaattct       240
     gaagtcagct tacttgaaga cgaagaagca ggcggcgtca aaattgctgc taaacttgtt       300
     gtcgaagtag ttggcgtaac agaagaagaa gcacaggact tgctggaaaa aacgcatcag       360
     ttctgcccgt attcaaaagc aacacgcggc aacatcgatg tggatttgtc agtaaaagtc       420
     gtggattctt tagacaacta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page