(data stored in ACNUC7421 zone)

EMBL: CP001022.PE528

CP001022.PE528       Location/Qualifiers
FT   CDS_pept        572509..572679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60016"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI6"
FT                   /protein_id="ACB60016.1"
FT                   /translation="MAPKETERPNEQFEDERKRLTDKERELSPEQQEEVLKGKDEMPDD
FT                   PVSPRDRGMDK"
     atggctccaa aagaaacgga acgaccaaac gaacagtttg aagacgaacg aaaacgtttg        60
     acggacaagg aacgtgagct ttcacccgaa caacaggaag aagtattaaa aggaaaagac       120
     gagatgccgg acgatccggt ttcaccgcga gaccggggaa tggacaagta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page