(data stored in ACNUC7421 zone)

EMBL: CP001022.PE53

CP001022.PE53        Location/Qualifiers
FT   CDS_pept        72548..73474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0054"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: oih:OB0082 chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59541"
FT                   /db_xref="GOA:B1YGQ8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ8"
FT                   /protein_id="ACB59541.1"
FT                   /translation="MKREELLAQLKDDYLVRALGFNGEVRAFAIRSTKTVYEAQLRHQT
FT                   TPVVTAALGRTLTIGAMMGTMQKGDTRVTLKVEGDGPIGKIIVDADAKGQVRGYVSHPR
FT                   VEMDTYVNGDGLTKLKVGDAVGRGNISVIKDLGLRDFVGGQSPIQTGEISEDFTYYFAV
FT                   SEQSPSVVGAGVLVYPEDESVIAAGGLIVQLMPGASEETIAALEQRVAALKPISILVGE
FT                   EKTPEEMLSLVLGESFEILDTIPVAFNCTCEREKLATAIVALGPDEIQAMIDEDGGAEA
FT                   VCHFCSEHYQYDVEELQSLREKSLERA"
     atgaaacgtg aagaattatt ggcacaacta aaagatgact acttggtcag agcactagga        60
     tttaacggtg aagtccgtgc ttttgcaatc cgttcgacaa aaacggtata tgaagcacaa       120
     ctccgtcatc agacgacacc tgtcgtcacg gcggcactcg gtcggacatt gacgatcggc       180
     gccatgatgg gaacgatgca aaaaggggat acccgcgtca cattaaaagt cgaaggtgat       240
     ggtccaatcg gaaaaatcat cgttgatgcc gatgcaaaag gacaagttcg cggatacgtc       300
     agccatccgc gtgtcgagat ggatacgtac gtcaatggtg acggtctgac gaaattaaaa       360
     gtcggcgacg ctgttggtcg cggaaatatc tcggttatca aagacttagg tctccgtgat       420
     ttcgtcggtg gacagtcgcc gattcaaacc ggtgaaatca gcgaagactt tacgtattac       480
     ttcgccgtct ccgagcaaag tccgtcggtc gtcggagcag gtgtcctcgt gtatccggaa       540
     gatgaatcag tcattgcagc aggcggtctg attgttcaat tgatgccggg tgcatcggaa       600
     gaaacgattg cggcactcga acaacgtgtg gcagcactca aaccgatctc gattttggtc       660
     ggtgaagaaa aaacaccgga agaaatgttg agcctggttc tcggtgaatc atttgagatc       720
     cttgatacga ttccggttgc tttcaactgt acgtgcgagc gtgaaaaatt agcaacggct       780
     atcgtggcac tcgggccgga tgagatccaa gcgatgattg acgaagatgg cggcgcggaa       840
     gcggtttgtc acttctgttc ggaacattac caatacgatg tcgaagaatt acaatcgctt       900
     cgtgaaaaat cactcgaaag agcataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page