(data stored in ACNUC7421 zone)

EMBL: CP001022.PE537

CP001022.PE537       Location/Qualifiers
FT   CDS_pept        579956..580321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0544"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: gka:GK0584
FT                   cadmium efflux system accessory protein (cadmium-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60025"
FT                   /db_xref="GOA:B1YJJ5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ5"
FT                   /protein_id="ACB60025.1"
FT                   /translation="MDAPRCETIAIDQVRAQEIEQVVDTIPTTDIGKLFKVLSDATRLR
FT                   IAYALTVEEELCVCDVSASVDCSIATASHHLRTLLKQGLVKYRKEGKVVYYSLDDHHIS
FT                   SLVHLAMEHVNEGKASS"
     gtggatgcac cacgttgtga aacgattgcg attgatcagg tacgtgcgca agagattgag        60
     caagtcgtcg atacgattcc gacgacagat atcggaaagt tattcaaagt cctgtcagat       120
     gccacgcgtc tgcggattgc ttacgcctta acggtagaag aggaactttg cgtctgtgat       180
     gtctcggctt cggtagattg ctcgattgca acagcttctc accatctccg caccttgctg       240
     aaacaaggtt tggtgaaata tagaaaagaa ggtaaggtcg tctactactc gttggacgat       300
     caccatatct catcgctcgt ccatctggcc atggagcatg taaacgaggg gaaagcgtcc       360
     tcataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page