(data stored in ACNUC7421 zone)

EMBL: CP001022.PE54

CP001022.PE54        Location/Qualifiers
FT   CDS_pept        73487..73798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_0056 possible peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59542"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ9"
FT                   /protein_id="ACB59542.1"
FT                   /translation="MGTVNSKYLWMLIFILLLTNFMTGAYAFMGELPKVDSPKIVQDSI
FT                   GGPLEDVVATVGDEEITRADLYQTMRKGHEKETLDRLIREAVEKQSENGSKPTVKRFD"
     atgggaactg taaactctaa gtacttgtgg atgttgattt ttattttgtt gctgacgaat        60
     tttatgacgg gtgcctatgc attcatgggc gaattgccga aagtcgattc accgaagatc       120
     gttcaggaca gtatcggcgg accgcttgag gatgtcgtcg cgacggtcgg agatgaagag       180
     attacacgtg ccgatctgta tcagacgatg cgtaagggtc atgaaaaaga aacccttgac       240
     cgtctgattc gggaagcagt cgaaaaacag tcggaaaacg gatcaaagcc gacagtaaag       300
     cgctttgatt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page