(data stored in ACNUC7421 zone)

EMBL: CP001022.PE547

CP001022.PE547       Location/Qualifiers
FT   CDS_pept        589124..589591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0554"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vvu:VV1_0730 ElaA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60035"
FT                   /db_xref="GOA:B1YJK5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK5"
FT                   /protein_id="ACB60035.1"
FT                   /translation="MYQTKWMGFNELDNTSLYQLLKLRTDIFVVEQNCPYPELDNRDQD
FT                   ALHGLAYDGERLIGCLRILPRKSSGAVAIGRVAVQTDYRSNGVARKLLNEAITHIEKQG
FT                   ESLIDLQAQAHLKRFYGSFGFKETSDVYLEDGIPHLDMQMNLREDSKRLQE"
     atgtatcaga caaagtggat ggggttcaat gagttggata atacaagctt gtatcaatta        60
     ttgaaattaa gaacagatat atttgtcgtg gagcagaatt gtccgtaccc ggaactcgat       120
     aaccgtgatc aagatgccct gcatggtctc gcatatgacg gcgaacgttt gattggttgc       180
     ctgcgcattt tgccgaggaa gtcgtcaggc gccgttgcaa tcggtcgggt agcggtccaa       240
     acggattacc ggtcaaacgg cgtagcaaga aaactgttga acgaagcgat tactcacatc       300
     gagaagcaag gggaatcatt gattgatctc caggctcagg cacatttgaa acggttttac       360
     ggttcctttg gttttaaaga aacgtccgat gtctatttag aggacggaat tcctcatcta       420
     gacatgcaaa tgaacttgag ggaagattca aaaagacttc aggaatag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page