(data stored in ACNUC7421 zone)

EMBL: CP001022.PE549

CP001022.PE549       Location/Qualifiers
FT   CDS_pept        590125..591057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60037"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK7"
FT                   /protein_id="ACB60037.1"
FT                   /translation="MKRFVKNEAIAPALNAFLTLENEAFQTYNQLLTAQERQALNFVGR
FT                   AVALQSDKHLALALETKQPLIEMDRLLMKLTEIEQGALLFRQLLASGLDLNQLITVEGH
FT                   RSLVRQPLSFPVGLYTVYDHVLFQLAVDSGLDLNYTTTLQRSDRFLETDEINTLDIVLL
FT                   LTHEQAPDEQSLPLFQHPATVGLAERLQRAKFESLQSIIENTRYVTTFRYAKHFPLFYA
FT                   IVGRQTEQFPKMLDAVLMEQNQEEILKDALLAFHNHQPGLATSMGTDYYESLFVIGDHL
FT                   KRQAGIDFNTLDDQYILSEYSEIVQRLRS"
     atgaaaagat ttgttaaaaa cgaagccatc gctccggcgc tgaatgcttt tcttacactt        60
     gagaacgaag cctttcaaac atataatcaa ttgctgacag cacaggagcg gcaagctttg       120
     aattttgtcg gacgggcggt cgcgcttcaa tcggacaaac atctcgcgtt agctcttgag       180
     acgaaacagc cgttgattga gatggaccgt ttactgatga aattgacgga aatcgagcag       240
     ggcgcgctgc tgtttcgaca gttgcttgca tccggtctcg atctgaatca acttatcaca       300
     gtcgaaggtc accggtcgct tgtcagacag ccgttatctt ttcctgtagg cttgtataca       360
     gtctatgacc acgtcttgtt tcaacttgcc gtcgattcgg ggttggacct aaactacaca       420
     acgacattgc aacggagtga ccgttttctt gaaacggatg aaatcaatac cctggacatc       480
     gtgttgttgt tgacgcatga gcaggcaccg gatgaacaga gtcttccgtt gtttcaacat       540
     ccggcgacag tcggtctggc agaacggctc caacgagcga agtttgaaag cctgcaatcc       600
     atcattgaga acacccggta tgttacaaca tttcgatatg ccaaacattt tccgcttttt       660
     tatgcgatcg tcggtcgtca gacggaacaa ttcccgaaga tgctagacgc tgttttgatg       720
     gaacaaaatc aggaagaaat tctaaaggat gccttattgg catttcataa tcatcaaccg       780
     ggtcttgcaa caagtatggg aacggattat tacgaaagtt tatttgtcat cggcgaccat       840
     ttaaagcgac aggcgggtat cgatttcaat acgttggatg atcaatatat actcagcgaa       900
     tactcggaaa tcgttcaacg gttacgtagt taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page