(data stored in ACNUC7421 zone)

EMBL: CP001022.PE555

CP001022.PE555       Location/Qualifiers
FT   CDS_pept        595487..596197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0562"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; KEGG: bpu:BPUM_1854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60043"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL3"
FT                   /protein_id="ACB60043.1"
FT                   /translation="MKVLVVGASGTIGARVVKSLAKGHQVTVIVRHQHLVERFEKLGVK
FT                   AHYVDIETELEKVIEQGVSGQDAVICAATAGVDGEPTEIELLDRTVALKTIDAAKKARV
FT                   RHFVLLSAYGADRPNQFKKEMYPFYAAKNAAEEQIEHSGLTYTIICPVNIVDGEGRGLI
FT                   EADEDLKDVKEATISETDVASILVAAVDNRALFNRRLEVKEGKTTLNEALGGDEAVGSV
FT                   KDNRQVKKQLPRYN"
     atgaaagtat tagttgtagg tgcatcaggt acaatcggag ctcgtgtcgt caagtcgctc        60
     gctaaaggtc atcaagtcac ggttatcgtc cgccatcagc atttagtgga acgatttgaa       120
     aaacttggtg ttaaagcgca ctatgtcgat atcgaaacag aactcgaaaa agtcatcgaa       180
     cagggtgttt ccggtcaaga cgctgtcatt tgtgcagcga cagccggtgt tgacggggaa       240
     ccgactgaaa tcgagttact ggaccggacg gttgctttaa aaacgattga tgctgcgaaa       300
     aaggcgcgtg ttcgtcattt cgtcctcctc agtgcctatg gtgctgatcg tccgaaccaa       360
     tttaaaaaag agatgtatcc gttctacgct gccaaaaatg cagccgaaga acagattgaa       420
     catagtggac tcacatatac gatcatttgt ccggttaaca tcgttgacgg agaaggacgc       480
     ggattgattg aggccgatga agacttgaag gatgtcaagg aagccacgat ttccgaaaca       540
     gatgttgcct ctatcctcgt cgctgccgtc gacaatcggg cgctctttaa tcgccgactg       600
     gaagtcaaag aaggtaaaac gacattaaac gaagcacttg gcggagatga ggcggttggc       660
     agcgttaaag ataaccgtca ggtcaaaaaa caattgccgc gttataatta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page