(data stored in ACNUC7421 zone)

EMBL: CP001022.PE558

CP001022.PE558       Location/Qualifiers
FT   CDS_pept        complement(597462..597671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_2562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60046"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL6"
FT                   /protein_id="ACB60046.1"
FT                   /translation="MIKRGTLERLDGKYAVLLWENGSSFIPRRYLPTEARLGDTILFDG
FT                   SNYSIDATNSTQSSFQTFSFRQMG"
     atgatcaaac gtggcacact ggaacggctt gatggcaaat atgctgttct tctctgggag        60
     aatggttcaa gtttcatccc acgccgctat ttgcctactg aagcaaggct tggtgataca       120
     atattattcg acggatctaa ttattcaatt gatgcaacta actctaccca gtcttccttt       180
     caaacgtttt cgtttcggca aatgggttga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page