(data stored in ACNUC7421 zone)

EMBL: CP001022.PE56

CP001022.PE56        Location/Qualifiers
FT   CDS_pept        74963..76351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0057"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Anthranilate synthase component I domain
FT                   protein; Chorismate binding-like; KEGG: bca:BCE_0067
FT                   para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59544"
FT                   /db_xref="GOA:B1YGR1"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR1"
FT                   /protein_id="ACB59544.1"
FT                   /translation="MRQTVYESFTWTKEQFYNRYVERTAGQTGHIWLESGRIGSYTMAG
FT                   VRPVGHIRTKNGRTIIQEAGQEKQYTDAPFTLLEEIRARYASARPEGMPPFFGGLAGYV
FT                   SYDAVRYLERLPEQAEDDLATADLSLYWYDEVAVFDHQTERLFIAVTRETEAEATLALA
FT                   AEVSSWRQSSPAPMFAAPEEKTAERGRSFERSAFMQAADRIKQYIEAGDVFQVNLAVRQ
FT                   QEPLRTTPAHIYDVLRTINPSPYMGYFADKELVLVSASPELLVEKIGLSLATRPIAGTR
FT                   PRGQNEEEDLALAKTLLDNEKERAEHVMLVDLERNDLGRVSRYGSVHVDELMVIEKYSH
FT                   VQHIVSNVRGEIAADETGSSVLAAMFPGGTITGAPKIRTMEIIEELEPVRRGIYTGALG
FT                   FISWADDVIFNILIRTLVAKDGMAYIQAGAGIVTDSDSESEYEESLSKAKALWVAKEMA
FT                   EGTT"
     gtgcgacaga cagtatacga atcatttaca tggacaaagg aacagtttta taaccggtac        60
     gttgaacgga cagccggaca gacaggtcat atctggcttg agagtggacg aatcggatcc       120
     tatacgatgg caggcgtccg gccggtcggt cacatccgga caaaaaacgg tagaacgatc       180
     attcaagaag ccggacaaga aaaacaatat accgatgctc catttacatt gctcgaagag       240
     attcgtgcgc gctatgcatc ggctcgtccg gaagggatgc cgccattttt tggaggatta       300
     gccggatatg tcagttacga tgccgttcgt tatcttgaac ggttgccgga acaggcagag       360
     gatgatttgg caacagccga tctttcgctt tactggtatg atgaggtcgc cgtatttgat       420
     catcagacag aacgattgtt tatagctgtc acacgggaaa cggaggcgga agcgacgctt       480
     gctttggcgg cagaagtttc atcgtggcgt cagtcgagtc cggctccgat gttcgcagca       540
     ccggaagaaa aaacggctga acggggacgt tcattcgaaa ggtccgcctt catgcaggca       600
     gctgaccgga tcaaacaata tattgaagcg ggagatgtct ttcaagtgaa ccttgccgtc       660
     cgccaacagg aaccgttgcg gacaacaccc gctcatattt atgatgtatt gcgaacgatc       720
     aacccgtctc cgtatatggg ttactttgca gataaagaat tggtactcgt ttcagcatcg       780
     ccggagttac tagtcgaaaa aatcggtctg tcactcgcga cccgtccgat tgccggaacc       840
     cggccgcgcg gacaaaatga ggaagaagac ctggcgttag cgaaaacgtt actcgacaat       900
     gagaaggaac gggcggagca tgtcatgctc gtcgatctcg agcgaaacga tttagggcgt       960
     gtcagccgct acggttccgt ccatgttgac gaattgatgg tcatcgaaaa atactcccac      1020
     gtccagcaca tcgtctcaaa cgtccgggga gagattgccg cagatgaaac cggcagcagt      1080
     gtcctggctg cgatgttccc gggaggtacg attacgggag cacctaaaat ccggacgatg      1140
     gagatcattg aagagcttga gcctgttcgc cgcggcatct atacaggagc cctcggtttt      1200
     atcagctggg cggacgatgt aattttcaat atcttgattc ggacgcttgt cgcgaaagat      1260
     ggtatggcct atattcaggc aggtgctggc atcgtaaccg actccgactc ggaaagtgaa      1320
     tatgaagagt cgctcagtaa agcaaaagca ctctgggtcg caaaagaaat ggcggaggga      1380
     acgacatga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page