(data stored in ACNUC7421 zone)

EMBL: CP001022.PE565

CP001022.PE565       Location/Qualifiers
FT   CDS_pept        603943..604998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0572"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG: bha:BH2896
FT                   carbamoyl phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60053"
FT                   /db_xref="GOA:B1YJM3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM3"
FT                   /protein_id="ACB60053.1"
FT                   /translation="MKGTGALTLADGHVYPGELIGSSSVQGEVVFFTGMTGYQEVLTDP
FT                   SYRGQIIVFTYPLIGQYGISEQDSESRQIQVSGVVVQTLANNGLRSDLADWLAASDIPV
FT                   LTQVDTRALVHHLRNQGDQIGILTCGTSSVQEQSNLIATVSIKQPEVYPTDYEAGHIVC
FT                   LDYGVKKSMIEALQERQMKVTVVPFDTPKTVIDELKPDGLLFSNGPGDPSQLDHLIPEI
FT                   NKLALAYPTLGICMGHQLIAKAFGCRIEKQHHGHRGANHPVRQLKTGRVFMTSQNHGYV
FT                   VQADSVQNSELNVAYEHINDGSIEGLLHPTHPILTVQFHPEAHPGPLEAMVIFDQFVAG
FT                   ILKQEVAYAGS"
     gtgaaaggaa caggggcatt aacattagcg gatggacatg tatatccagg tgaattgatt        60
     ggttcctcgt ccgttcaagg agaagttgta tttttcacgg gaatgaccgg ttatcaagaa       120
     gtattgaccg atccttccta ccggggacaa atcatcgttt ttacctaccc gctcattgga       180
     caatacggaa tttcagaaca ggattcagaa agccgtcaga ttcaagtatc cggtgtagtc       240
     gttcagacct tagcgaacaa cggattacgg tcagacttgg cggattggtt ggcagcatcg       300
     gatatcccag ttttaacaca agtcgataca cgggcattgg tccatcattt acgcaatcag       360
     ggggatcaga tcggtatcct cacatgcggg acatcatctg ttcaggaaca gtcgaacttg       420
     attgccaccg tctcgatcaa acagccggag gtttatccaa ccgattacga ggccggacat       480
     atcgtgtgtc tcgattacgg ggtgaaaaaa tcgatgattg aagccttgca ggagcgtcag       540
     atgaaagtga cggtcgtgcc gttcgataca ccgaaaacag tcatcgatga attaaagcct       600
     gacgggttac ttttttcgaa tggacccgga gatccgagcc aactcgatca cttgattcca       660
     gaaatcaata aactggcact tgcctatccg acgcttggca tctgcatggg gcatcaactg       720
     attgccaagg ccttcggatg tcgaatcgaa aagcaacacc atggtcaccg tggggcaaat       780
     catccggtcc gtcagttgaa aaccggacgt gtcttcatga catcacaaaa tcatggttat       840
     gtcgttcaag cggacagcgt gcaaaattct gaactgaacg tcgcttatga acatatcaat       900
     gacggctcga ttgaaggact gcttcatccg acgcatccta ttttgacggt tcagtttcac       960
     ccggaagctc atcccggtcc actggaagcg atggtgatat ttgatcaatt cgtagcgggc      1020
     atcttaaagc aggaggtagc atatgcagga agttaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page