(data stored in ACNUC7421 zone)

EMBL: CP001022.PE567

CP001022.PE567       Location/Qualifiers
FT   CDS_pept        608014..608952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0574"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: bpu:BPUM_1048 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60055"
FT                   /db_xref="GOA:B1YJM5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM5"
FT                   /protein_id="ACB60055.1"
FT                   /translation="MTTTQRLKHLLTLEELTAEGLTDLLELAKDVKASPATYAQTLAGK
FT                   KVALLFEKASTRTRISFEVGVVELGGYPVVLNGSDMQIGRGESLSDTIQVMSRYVDALM
FT                   IRTFAHETVETLAAHGTIPIINGLTDLHHPCQVLADLLTIEEHFGQRKGKILAYIGDGN
FT                   NMTHSLLLGGALSGMTVRICSPAAYAPDQTIIDQAKMLAQQSGGQIEQYTDPVQAVAGA
FT                   DVIYSDVFASMGQEEESEARLKAFEGYQVNQTLLSSAATDVIFLHCLPAHRGEEVTAEV
FT                   IDGSHSLVFDQAENRLHAQKALMIELIGVMD"
     atgacgacta cacaacgatt aaagcatttg ctgacactgg aagaactgac agcagaagga        60
     ctgaccgatc tattggaact ggcgaaagat gttaaagctt ctccagcgac atatgcccaa       120
     acacttgccg gaaaaaaagt cgcgttgctg tttgaaaaag catcgacgcg gacacggatt       180
     tcttttgagg tcggtgtcgt cgaattggga ggatatccgg tcgtcttaaa cggatcggat       240
     atgcagattg gtcgcggaga gtccctcagc gatacgattc aagtcatgag ccgttatgtc       300
     gacgccttga tgatccggac gtttgcacat gaaacggtcg agacgttggc agcgcacgga       360
     acgattccga tcattaacgg attgacggac ctccatcatc cgtgtcaggt cttggcagat       420
     ttattgacga tcgaggagca ttttggtcaa cgtaaaggaa agatattggc ttatatcggg       480
     gacggaaaca acatgacgca ctcgttgctt ttaggcggcg cgttaagtgg aatgaccgtt       540
     cgaatttgta gtccggctgc ttatgcaccg gatcaaacga ttattgacca ggcgaagatg       600
     ctggcacaac aatccggagg acagattgaa caatatacgg atcctgttca agcggttgcc       660
     ggtgctgatg tcatttacag tgatgtattc gccagtatgg gtcaggaaga ggagtcggaa       720
     gcacgtctca aggcattcga aggctatcaa gtgaatcaaa cgttgttgtc gtcagcagca       780
     acggatgtga ttttcctgca ttgtcttccg gcgcaccgcg gggaagaagt gacagcggaa       840
     gtcattgacg gcagtcactc ccttgtattt gatcaggcgg aaaaccgcct tcatgcgcaa       900
     aaagctttaa tgattgaact gattggagta atggattaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page