(data stored in ACNUC7421 zone)

EMBL: CP001022.PE568

CP001022.PE568       Location/Qualifiers
FT   CDS_pept        complement(609005..609814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0575"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   oih:OB0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60056"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM6"
FT                   /protein_id="ACB60056.1"
FT                   /translation="MIQMKMPGVMVYQSTLMKTTSTLIETPDCLIVVDPGWLPDEIATI
FT                   RRDVEIIRHDRPLYIVYTHAHFDHILGAYAFKDAIAIASRRFVDVDRTAALEEVQNFND
FT                   EYYIESPVLFPDITHVIEESETTLTIGKTKLIFFLTPGHESTHLSFVVMPLHLLVCGDY
FT                   ASDVEIPLIEHDSSEYLTTLELLESFIYEYEVKLLIPGHGHICDVRTEMIERLHLSYDY
FT                   ILALRAHKESDWSPSWQRTSFMGRLHEKNKRQITKEQTEQLARRQYD"
     atgattcaaa tgaagatgcc cggcgtcatg gtgtaccaaa gtacattaat gaaaacgacc        60
     tcgactttga ttgagactcc cgattgtctg atcgtcgttg atccgggttg gttaccggac       120
     gagatcgcaa cgatccgccg tgatgtggaa atcatccggc acgatcggcc tctctatatc       180
     gtgtatacgc atgctcattt tgatcatatt ctaggagctt acgcttttaa agatgcaatt       240
     gcgattgctt cccgtcgttt cgtggatgtc gaccggacag cagcgcttga agaagtgcag       300
     aactttaatg acgagtacta catcgagtct cccgttctgt ttccggatat cacacatgtc       360
     atcgaagaat ccgaaacgac gttgacgatc ggtaaaacca aactgatttt tttcctgact       420
     cccggtcatg aatcaaccca tttgtctttt gtcgtcatgc cgcttcatct ccttgtctgt       480
     ggtgactatg cctccgacgt cgaaattccg ttgattgaac atgattcgag tgaatactta       540
     acgacccttg aattactcga atcctttatt tatgaatatg aggtaaagtt acttattccg       600
     ggacatggtc atatttgtga cgttcgcacg gaaatgattg agcggcttca tttgagttac       660
     gactacatct tggccttacg tgcacacaaa gagtcggact ggtcgccgtc gtggcaacgc       720
     acgtccttca tgggacgtct gcacgaaaaa aataaacgcc agattacgaa agaacagacc       780
     gagcaactcg cccggcggca atacgattaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page