(data stored in ACNUC7421 zone)

EMBL: CP001022.PE577

CP001022.PE577       Location/Qualifiers
FT   CDS_pept        617702..618295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0584"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   btl:BALH_0738 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60065"
FT                   /db_xref="GOA:B1YJN5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN5"
FT                   /protein_id="ACB60065.1"
FT                   /translation="MLEWLFSAGESNLWLFLGIMILGLGTELIPAEVGLPLLGLYVSNG
FT                   TISWTAAVLIGFIGSLMGATLFYFLGRYAGRPILVRYGKWLMIKEREIIQGERIVSKYG
FT                   SWSALFGRFFPVVRSVVSIPCGLFNLSFKRYVLASSIGLFPVSFFYVWLGEKFGVERAE
FT                   SMLKGLEQELWWILGIIVVGIIGYIMYRRLKSKR"
     atgctggaat ggttattctc agccggagag tcgaatctct ggctgttttt aggaattatg        60
     attcttggac tcgggacgga attaattccg gctgaagtcg gtttgccgtt actcggtctg       120
     tatgtttcaa acggaacgat cagttggacg gcagctgtcc taatcggttt catcggcagt       180
     ctgatgggcg cgacgctatt ttactttctc ggtcgttacg ccggacgtcc gattttggtt       240
     cgctacggaa aatggttgat gatcaaggaa cgggaaatca ttcagggaga acgaatcgta       300
     tcgaaatacg gttcatggtc tgccttgttc ggtcgtttct tcccggtcgt ccgttcggtc       360
     gtctcgattc cgtgtggtct gtttaacttg tcgttcaaac gatacgtcct cgcctcgagc       420
     attggtttgt tcccggtttc gtttttttat gtttggctgg gagagaagtt tggggtggaa       480
     cgggcagagt ccatgctgaa ggggcttgaa caggaattat ggtggattct cggcatcatt       540
     gtcgttggaa tcatcggcta catcatgtat cgccgcttga aatcgaagcg ttaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page