(data stored in ACNUC7421 zone)

EMBL: CP001022.PE579

CP001022.PE579       Location/Qualifiers
FT   CDS_pept        619990..621276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0586"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cbe:Cbei_0230 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60067"
FT                   /db_xref="GOA:B1YJN7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN7"
FT                   /protein_id="ACB60067.1"
FT                   /translation="MRKRKWAALPVMTTAMVVALAACGGGGTLNSDDSKDSGSSKDGKT
FT                   LNVFQFKAEIAKDMEKMAKAYEKETGVKVVVQTVGGGSDYGAALKSQFASGNEPDVFNN
FT                   GGFTEAKTWQDKLEDLSDEKWVSDLTDLSKEPMTIDGKLYGMPMNLEGYGFIYNKEIFK
FT                   KAGITELPKTLTELTEASKKLKADGVTPFSIGYGEWWILGNHLMNIPMAQQDDPDQFIA
FT                   DLNSGKGKFEDNKQFKEFMNLFDLTIEYGNKNPLTTDYNTQVSQFAEGKTAMIQQGNWA
FT                   QQLITDVNPDIEMGFIPMPINDDKEKMDRLPVGVPNNWVVNKNSKNKEEGKKFLEWMAT
FT                   SDTGKDYMVNKFKFIPAFKSIEAADLGPLADDIIKYSKEDKTISWNWFKYPDGAVNEFG
FT                   AIMQAYVGKQKTSEEMLQDFTKTWQKMKK"
     atgcgtaaac gtaaatgggc agcactacca gttatgacga ccgcaatggt cgtagcactt        60
     gcagcatgtg gtggcggtgg aacactcaat agtgatgact caaaggacag tggctcttct       120
     aaggacggga agaccctcaa cgtattccaa tttaaagctg aaatcgcaaa agacatggaa       180
     aagatggcaa aggcgtatga aaaagaaacg ggcgtaaaag tcgtcgttca aacagtcggc       240
     ggcggatcgg attatggcgc cgccttgaaa tctcagtttg cttcgggtaa cgaaccggat       300
     gttttcaaca acggtggatt tacagaagcg aaaacatggc aagataagct ggaagatctt       360
     tcggatgaaa agtgggtcag tgatttaaca gacctatcaa aagaaccgat gacaattgac       420
     gggaaactgt atggtatgcc gatgaacttg gaaggttacg gtttcattta caacaaagaa       480
     atcttcaaga aagccggtat tacagagttg ccgaaaacgt taacagaatt aacagaagcg       540
     tccaagaagc tgaaagcgga cggcgtgaca ccattctcga tcggatacgg cgagtggtgg       600
     attcttggaa atcacttgat gaatatcccg atggcccaac aggatgatcc ggatcagttc       660
     atcgccgatc tgaattccgg caaagggaag ttcgaagaca ataaacaatt taaagagttc       720
     atgaatctgt ttgatttaac gatcgagtac ggaaacaaaa atccgttgac gacagattac       780
     aatacacaag tttcacagtt tgctgaagga aaaacagcaa tgatccaaca aggaaactgg       840
     gcgcaacaat tgattacgga tgtcaatccg gatatcgaga tgggcttcat tccgatgccg       900
     atcaatgatg acaaagaaaa aatggatcga cttccggtcg gcgtaccgaa taactgggtc       960
     gtcaacaaaa actcgaaaaa taaagaagaa ggtaaaaagt tcctcgagtg gatggcgaca      1020
     tctgatacag gaaaagatta tatggtcaac aaattcaagt ttatcccggc gttcaaatca      1080
     atcgaagcag ccgatcttgg accacttgct gacgatatca tcaagtactc taaagaagat      1140
     aaaaccatct catggaactg gtttaaatat ccggacggtg ctgtcaacga atttggtgcc      1200
     atcatgcagg catacgtagg aaaacaaaaa acatcagaag agatgttaca agactttacg      1260
     aagacttggc aaaaaatgaa gaaataa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page