(data stored in ACNUC7421 zone)

EMBL: CP001022.PE586

CP001022.PE586       Location/Qualifiers
FT   CDS_pept        628793..629182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0593"
FT                   /product="glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="KEGG: bcl:ABC3101 glycerol-3-phosphate
FT                   cytidylyltransferase; TIGRFAM: cytidyltransferase-related
FT                   domain protein; glycerol-3-phosphate cytidylyltransferase;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60074"
FT                   /db_xref="GOA:B1YJP4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP4"
FT                   /protein_id="ACB60074.1"
FT                   /translation="MKKVITYGTFDLLHWGHINILKRAKEMGDYLVVAISTDEFNRLKH
FT                   KESYHSFENRKLILESIRYVDEVIAENNWDQKITDVQEHQIDTFVMGDDWAGEFDFLKE
FT                   YCEVVYLSRTEGISTSQIKTELGKG"
     atgaaaaaag tcatcacgta cggcacattt gatttactgc actggggaca tatcaacatc        60
     ctcaaacggg caaaggaaat gggcgattat ttagtagttg cgatttctac ggacgagttc       120
     aatcgcttaa aacacaaaga gtcatatcac agtttcgaaa accgcaaatt gattttggaa       180
     tcgattcgct acgtggacga agtcattgcc gaaaataact gggatcaaaa aatcacggat       240
     gtacaagagc accaaatcga tacattcgtc atgggtgacg actgggccgg cgaattcgac       300
     ttcttgaaag aatattgtga agtcgtttac cttagccgga cggaaggcat ttcgacaagc       360
     cagattaaaa cggagttagg aaaaggttga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page