(data stored in ACNUC7421 zone)

EMBL: CP001022.PE588

CP001022.PE588       Location/Qualifiers
FT   CDS_pept        630543..631250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0595"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: gka:GK0788 transcriptional regulator (FNR/CRP
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60076"
FT                   /db_xref="GOA:B1YJP6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP6"
FT                   /protein_id="ACB60076.1"
FT                   /translation="MLACGTTEANTFVLSAETRMILEDFMTEVTFKKDSIVCWEGELND
FT                   KLFYVKQGGVKLSKLTKKGSPLMMFLYFKGDLFGEFDVGEAFPSSYSIETMEDSILGVI
FT                   SKSKLEELMKQDGVFALEIMRWQALMRKQSETKLRDLLLFGKQGALASTLLRLIAMHGK
FT                   QVGEDYVISKRPSDSELGQLIGAPRETVNRMFSQWKKDKVISSTTTKIIVHDANYLRDL
FT                   CHCEGCPVGVCRI"
     atgcttgctt gcggaacgac tgaagccaat acgtttgtct tatcggcaga aacacgaatg        60
     atactggaag acttcatgac agaggtgacg tttaaaaagg attccatcgt ttgttgggaa       120
     ggtgagttaa acgataagtt gttttacgtg aagcagggtg gtgtcaaact atcgaaactg       180
     acgaaaaaag gcagtccttt aatgatgttt ttatacttta aaggagattt gttcggtgag       240
     tttgatgtcg gtgaagcatt tcccagttct tatagcattg aaacgatgga agacagtata       300
     ctgggtgtca tttcgaaaag taagcttgag gaattgatga agcaggatgg tgtgtttgcc       360
     ttggaaatca tgcgctggca agccttgatg cggaagcagt ccgaaacgaa attgcgtgac       420
     ttgttattgt ttgggaaaca aggggcactg gcttcgacct tacttcgttt gattgccatg       480
     catgggaaac aagtcgggga agattacgtc atatccaaac gaccgtccga cagcgaactc       540
     ggtcagttga tcggggcacc acgtgaaacg gtcaatcgta tgttttccca gtggaaaaaa       600
     gacaaggtca tttcatcgac gacaaccaaa atcatcgtcc atgatgcgaa ctatttaaga       660
     gatttgtgtc attgtgaagg atgcccggta ggggtgtgtc ggatttaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page