(data stored in ACNUC7421 zone)

EMBL: CP001022.PE591

CP001022.PE591       Location/Qualifiers
FT   CDS_pept        632165..633856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0598"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   gtn:GTNG_1394 subunit I of b(o/a)3-type cytochrome c
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60079"
FT                   /db_xref="GOA:B1YJP9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP9"
FT                   /protein_id="ACB60079.1"
FT                   /translation="MNAISKKLKEFEMERGLPATAIGLKEAKLAFAHVSFSLVALLIGG
FT                   LCGLLQTLVRTGVIPEIAGIGYYELLTAHGLMLAIVFTTLFIFGLLFSFLGQSFGRFEE
FT                   FPRRLGWVGFWFMMLGVVLVTWMVLAGEASVLYTFYAPLKAHPVFYIGLVIFVVGTWIS
FT                   SGAMFRMYADYKREHKGVHPPLQAYMSIMTVLLWVVATLGVAATILFQLLPLSLGWTDK
FT                   VGIELSRTLFWYFGHPLVYFWLLPAYIVWYTVIPKIVGGKVFSDALARMSFLLFLLFSF
FT                   PVGFHHQLLEPGISAFWKYIQVVLTFLVIIPSLMTAFSMFATFELAGRRQGASGLFGWI
FT                   KKMPYRDVRFLAPFIGMLFFIPAGAGGVINASHQLNIVVHNTLWVTGHFHITVGAAVAL
FT                   TFFGTAYWLVPLLRGRTLTKQINRIGLVQTMLWTIGMLFMSTAMHISGLLGNPRRTGPA
FT                   AYFKDSLVADWIPYHVAMAIGGTILFLSILLFLFAMFQLAFRAPKGTEEFPVAETEEAA
FT                   MQTPLFFENWKLWIFVTFALIAFAYTVPIWHMIENAPPGAPGWKLW"
     atgaatgcca tttccaagaa gttaaaggag tttgagatgg agcgtggtct tcccgctaca        60
     gccattggat tgaaggaagc taaactggcc tttgcccatg tcagcttttc gctggtggcg       120
     ttgctgatcg gtggattgtg cgggttgttg caaaccctcg tccggacagg tgtcatcccg       180
     gaaattgcag gcatcggtta ttacgaattg ttgactgctc acggattaat gctggcgatt       240
     gtgtttacga ccttatttat tttcggatta ttattttcct ttttaggaca atcgtttggt       300
     cgttttgagg aattcccaag acgtctcggt tgggtcggct tttggttcat gatgctgggt       360
     gttgtccttg tcacatggat ggtccttgca ggagaagctt cggttttata taccttttat       420
     gcaccgttaa aagcacaccc ggtgttctat atcggactcg tcatcttcgt tgtcgggacg       480
     tggatctctt caggtgcgat gttccggatg tacgcggatt ataaacggga gcataaaggt       540
     gtccatccgc cgctgcaggc ctacatgagt atcatgacag tgttattgtg ggtggttgcg       600
     acactcggtg tcgctgcaac gattctattt cagctgttac cgttgtcact cggttggaca       660
     gacaaagtcg gaattgagtt gtcccggaca ctcttttggt acttcgggca tccgctagtg       720
     tatttttggc tgctgccagc gtatatcgtc tggtataccg tcattccgaa aatcgtcggc       780
     ggaaaggttt tttctgatgc cttggcccgg atgtcctttt tactattctt attgttttct       840
     ttcccggtag gatttcatca tcaattgctg gagccgggta tctcggcctt ttggaaatac       900
     attcaggttg ttctcacatt tttggtcatc attccgtcac tcatgacagc attctcgatg       960
     tttgcgacgt ttgaactggc ggggcgccga cagggtgcaa gcggattatt cgggtggatc      1020
     aagaaaatgc cgtatcggga cgttcgcttt ttagcgccgt tcatcgggat gttatttttc      1080
     attccggccg gagccggcgg ggtcatcaat gcgtcccatc aattaaacat cgtcgtccat      1140
     aacacactgt gggtgacagg acattttcat atcacagtcg gagcggccgt tgcactgacg      1200
     ttttttggaa cggcctactg gctggtgccg ttgctcagag gacggacgtt gacgaaacaa      1260
     atcaatcgga tcggactggt tcaaacgatg ttatggacga ttggtatgct gtttatgtcg      1320
     acagcgatgc acatctcagg actactcggt aacccgagac ggaccggtcc tgcggcttac      1380
     tttaaggatt ctcttgtcgc cgactggatt ccttatcatg tggcgatggc gatcggcgga      1440
     acgattttat tcctgtcgat tctgctgttc ttatttgcga tgttccagct cgctttccgg      1500
     gcaccgaaag ggacagaaga gtttcctgtc gctgaaacag aagaagcggc aatgcagacg      1560
     ccgctgttct tcgagaattg gaaactttgg attttcgtga cgtttgcgtt aattgcgttt      1620
     gcctatacgg ttccgatttg gcatatgatt gaaaatgcgc cgccgggtgc gccgggctgg      1680
     aaactctggt ga                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page